Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1642) | |||||
---|---|---|---|---|---|
DME Name | Endoglucanase Y (EGY), Lactobacillus johnsonii | ||||
Synonyms | Endo-1,4-beta-glucanase Y; SGNH_hydro domain-containing protein Y; Cellulase Y; EGY; CBG24_05650 | ||||
Gene Name | EGY | ||||
UniProt ID | |||||
EC Number | EC: 3.2.1.136 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus johnsonii (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKKYQPTDLIKFASRTGRWTIKKLDNSPTLYTTNLGSYLRFKVSDAKKCQITVLPNQNSL
SPSQVFAFRIDGGKWQRAQASLEKIDIPLDSTLHTIEIMAAGNTDIDEVWQGNEGFAIKN IYLDRGEITAAPQRPLINFIGDSITAGCWVVGNHPAADYRPETNYAGICADLLNVDSVRI AYSAGGVLRPATGGVPTADVFLGKIDNQTLWTPNHPDLNVINLGVNDRRFPLTQFIAAFD LFIQQVKLTFPHTPLAIIIPFSQTFASAIRTIATKHDCSIIETKTWHHSFTDGLHPDQAG AINEGKMLAQALQPLLPQFSVQ |
||||
Function | This enzyme hydrolyzes 1,4-linkages in beta-D-glucans also containing 1,3-linkages. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 4 Drugs | ||||
Amikacin |
Drug Info | Approved | Pseudomonas infection | ICD11: 1G40 | [1] |
Gentamicin |
Drug Info | Approved | Acute upper respiratory infection | ICD11: CA07 | [1] |
Kanamycin |
Drug Info | Approved | Pulmonary tuberculosis | ICD11: 1B10 | [1] |
Streptomycin |
Drug Info | Approved | Infectious endocarditis | ICD11: BB40 | [1] |
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Colistin |
Drug Info | Phase 4 | Pneumocystis pneumonia | ICD11: CA40 | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.