Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1905) | |||||
---|---|---|---|---|---|
DME Name | Cytochrome P450 147G1 (cyp147), Mycobacterium marinum | ||||
Synonyms | Cytochrome P450 family 147 subfamily G member 1; P450 147G1; MMAR_2930; P450 147G1; cyp147G1 | ||||
Gene Name | cyp147G1 | ||||
UniProt ID | |||||
EC Number | EC: 1.14.15.28 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Mycobacterium marinum (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human skin. | ||||
Sequence |
MNAETAWAEAMKFENRPNPYPYFDELRKTPVAKVAEKTYVVTGYRELLALAHDPRISSDI
TRSPSGFGGEAPQPEPGSEHVQAYGQDASIIVSDPPDHDRARRQVMRHFAPPHSPDLIPS MEPFVVRLANDLLNQASARGSTRLDVVEDFAYPIPVAVICKILGVPIEDEPKFHAWIFDF MAGTDLGPEGDTEEGQVLAEKGRVSTAALTDYLGDLVRSYAKTPGEGLLSKLLHDDGPDG PMSVPETTANALLLLVAGHDSTVNTITNCVMTLLRNPGSWDLVRQRPELIPRTIEEVQRL QSAVQFFPSRSATDEIEIGGTVIPAGSAVHLIYAAANRDPRRFDNPNRFDPLREDNEHFG WGSGIHTCMGGPLARLEVNLAVEIFLRRVQSPKLVVDPPPYRHNQIFRGPRHLWVDFAAI TE |
||||
Function | This enzyme catalyzes the selective hydroxylation of linear and -2 methyl branched fatty acids at the -1 position. Substrates of Cytochrome P450 147G1 include fatty acids ranging from octanoic to hexadecanoic acid. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Omega-3 Fatty acids |
Drug Info | Phase 4 | Periodontal disease | ICD11: DA0C | [1] |
References | |||||
---|---|---|---|---|---|
1 | Selective Omega-1 oxidation of fatty acids by CYP147G1 from Mycobacterium marinum. Biochim Biophys Acta Gen Subj. 2019 Feb;1863(2):408-417. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.