Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1918) | |||||
---|---|---|---|---|---|
DME Name | Alcohol dehydrogenase (ADH), Lactobacillus brevis | ||||
Synonyms | Alcohol dehydrogenase AdhP; Zinc-dependent alcohol dehydrogenase; Zn-dependent alcohol dehydrogenase; AZI09_07320; AZI11_05495; CCS05_05540; CNR29_05565; LbDm2_0383; NCTC13386_01440; UCCLBBS449_1499; adhA_1 | ||||
Gene Name | adhA_1 | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.1.1.1 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Lactobacillus brevis (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKAAVIRDSVDGYVDIKDVTLRPITHGEALVKMEYCGLCHTDLHVAAGDFGKQPGRIIGH
EGVGKVIQVADDVDNLKIGDRVSVAWFFKGCGHCEYCLTGRETLCRNVQNSGFTVDGAMA EECIVDANYAVKVPEGLDPIEATSLTCAGVTMYKALKVGETKPGQWVEVVGAGGLGNLAI QYAHNVFGAHVVAVDGNPDKLAAAKANGAEVLINRHDGNVAEQIQEKVGGVDNAQVTAVN KDAFTQSVNALKPDGKLVAVALPQGDMELNIAKTVLDGISVRGSLVGTRQDLAETFQFGA EGKVHPIVKTRRLDEVNDIIDEMKNNQIVGRMVVDFTK |
||||
Function | This enzyme acts on primary or secondary alcohols or hemi-acetals with very broad specificity and the enzyme oxidizes methanol much more poorly than ethanol. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Prochiral ketones |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.