Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN007)
DME Name Sulfotransferase 1A4 (SULT1A4), Homo sapiens
Gene Name SULT1A4
UniProt ID
ST1A4_HUMAN
EC Number    EC: 1.14.13.39     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
Oxygen paired donor oxidoreductase
NADH/NADPH donor oxidoreductase
EC: 1.14.13.39
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDM
IYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLD
QKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNY
TTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          2 Drugs
Levodopa
 Drug Info Approved Parkinsonism ICD11: 8A00 [1]
Acetaminophen
 Drug Info Approved Anaesthesia ICD11: 8E22 [2]
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:          2 Drugs
Mestranol
 Drug Info Phase 4 Menorrhagia ICD11: GA20 [3]
Phenacetin
 Drug Info Phase 4 Anaesthesia ICD11: 8E22 [4]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000049 Acetaminophen Acetaminophen sulfate Conjugation - Sulfation Acetaminophen [5], [6], [7]
MR002726 Ethinyl estradiol Ethinylestradiol-3-sulfate Conjugation - Sulfation Ethinyl estradiol [3]
MR002727 Ethinyl estradiol Ethinylestradiol-3,17-sulfate Conjugation - Sulfation Ethinyl estradiol [8]
MR002728 Ethinyl estradiol Ethinylestradiol-17-sulfate Conjugation - Sulfation Ethinyl estradiol [8]
MR001490 Dopamine Dopamine-3-O-sulfate Conjugation - Sulfation Levodopa [1]
MR001491 Dopamine Dopamine-4-O-sulfate Conjugation - Sulfation Levodopa [1]
⏷ Show the Full List of 6 MR(s)
References
1 DrugBank(Pharmacology-Metabolism)Levodopa
2 Metabolism and Effects on Endogenous Metabolism of Paracetamol (Acetaminophen) in a Porcine Model of Liver Failure. Metabolism and Effects on Endogenous Metabolism of Paracetamol (Acetaminophen) in a Porcine Model of Liver Failure
3 Sulfotransferase 1E1 is a low km isoform mediating the 3-O-sulfation of ethinyl estradiol Drug Metab Dispos. 2004 Nov;32(11):1299-303. doi: 10.1124/dmd.32.11..
4 DrugBank(Pharmacology-Metabolism)Phenacetin
5 Simultaneous quantification of abemaciclib and its active metabolites in human and mouse plasma by UHPLC-MS/MS J Pharm Biomed Anal. 2021 Sep 5;203:114225. doi: 10.1016/j.jpba.2021.114225.
6 Application of a Volumetric Absorptive Microsampling (VAMS)-Based Method for the Determination of Paracetamol and Four of its Metabolites as a Tool for Pharmacokinetic Studies in Obese and Non-Obese Patients. Clin Pharmacokinet. 2022 Dec;61(12):1719-1733. doi: 10.1007/s40262-022-01187-2.
7 Evaluation of urinary acetaminophen metabolites and its association with the genetic polymorphisms of the metabolising enzymes, and serum acetaminophen concentrations in preterm neonates with patent ductus arteriosus. Xenobiotica. 2021 Nov;51(11):1335-1342. doi: 10.1080/00498254.2021.1982070.
8 The pharmacokinetics and metabolism of ethinyl estradiol and its three sulfates in the baboon Am J Obstet Gynecol. 1983 May 1;146(1):80-7. doi: 10.1016/0002-9378(83)90931-6.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.