Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN018)
DME Name Alcohol dehydrogenase (quinone), cytochrome c subunit (adhB), Gluconobacter oxydans
Gene Name adhB
UniProt ID
ADHB_GLUOX
Lineage    Species: Gluconobacter oxydans     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Pseudomonadota
Class: Alphaproteobacteria
Order: Rhodospirillales
Family: Acetobacteraceae
Genus: Gluconobacter
Species: Gluconobacter oxydans
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MLNALTRDRLVSEMKQGWKLAAAIGLMAVSFGAAHAQDADEALIKRGEYVARLSDCIACH
TALHGQPYAGGLEIKSPIGTIYSTNITPDPEHGIGNYTLEDFTKALRKGIRKDGATVYPA
MPYPEFARLSDDDIRAMYAFFMHGVKPVALQNKAPDISWPLSMRWPLGMWRAMFVPSMTP
GVDKSISDPEVARGEYLVNGPGHCGECHTPRGFGMQVKAYGTAGGNAYLAGGAPIDNWIA
PSLRSNSDTGLGRWSEDDIVTFLKSGRIDHSAVFGGMADVVAYSTQHWSDDDLRATAKYL
KSMPAVPEGKNLGQDDGQTTALLNKGGQGNAGAEVYLHNCAICHMNDGTGVNRMFPPLAG
NPVVITDDPTSLANVVAFGGILPPTNSAPSAVAMPGFKNHLSDQEMADVVNFMRKGWGNN
APGTVSASDIQKLRTTGAPVSTAGWNVSSKGWMAYMPQPYGEDWTFSPQTHTGVDDAQ
Function Cytochrome c component of the alcohol dehydrogenase multicomponent enzyme system which is involved in the production of acetic acid and in the ethanol oxidase respiratory chain. Quinohemoprotein alcohol dehydrogenase (ADH) catalyzes the oxidation of ethanol to acetaldehyde by transferring electrons to the ubiquinone embedded in the membrane phospholipids. The electrons transfer from ethanol to membranous ubiquinone occurs from pyrroloquinoline quinone (PQQ) to one heme c in subunit I (AdhA), and finally to two heme c in subunit II (AdhB). Besides ubiquinone reduction, ADH also has a ubiquinol (QH2) oxidation reaction which mediates electron transfer from ubiquinol to the non-energy generating bypass oxidase system. The electrons transfer occurs from ubiquinol (QH2) to the additional heme c within subunit II (AdhB). Also able to use quinone analogs such as 2,3-dimethoxy-5-methyl-6-n-decyl-1,4-benzoquinone (DB) and 2,3-dimethoxy-5-methyl-6-n-pentyl-1,4-benzoquinone (PB).
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Celecoxib
 Drug Info Approved Rheumatoid arthritis ICD11: FA20 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000585 Hydroxycelecoxib Carboxycelecoxib Unclear - Unclear Celecoxib [2]
References
1 Celecoxib pathways: pharmacokinetics and pharmacodynamics Pharmacogenet Genomics. 2012 Apr;22(4):310-8. doi: 10.1097/FPC.0b013e32834f94cb.
2 Celecoxib pathways: pharmacokinetics and pharmacodynamics. Pharmacogenet Genomics. 2012 Apr;22(4):310-8.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.