Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN045)
DME Name Thymidine kinase 2 (TK2), Homo sapiens
Gene Name TK2
UniProt ID
KITM_HUMAN
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MLLWPLRGWAARALRCFGPGSRGSPASGPGPRRVQRRAWPPDKEQEKEKKSVICVEGNIA
SGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYHDASRWGLTLQTYVQLTMLDR
HTRPQVSSVRLMERSIHSARYIFVENLYRSGKMPEVDYVVLSEWFDWILRNMDVSVDLIV
YLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHH
MERMLELFEQNRDRILTPENRKHCP
Function Phosphorylates thymidine, deoxycytidine, and deoxyuridine in the mitochondrial matrix. In non-replicating cells, where cytosolic dNTP synthesis is down-regulated, mtDNA synthesis depends solely on TK2 and DGUOK. Widely used as target of antiviral and chemotherapeutic agents.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Gemcitabine
 Drug Info Approved Breast cancer ICD11: 2C60 [1]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Clevudine
 Drug Info Phase 3 Hepatitis B virus infection ICD11: 1E50-1E51 [2]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR012100 Clevudine L-FMAUDP Unclear - Unclear Clevudine [2]
MR001121 Gemcitabine Gemcitabine Monophosphate Other reaction - Phosphorylation Gemcitabine [1], [3]
MR013480 Valaciclovir Acyclovir monophosphate Conjugation - Phosphorylation Valacyclovir Hydrochloride [4]
References
1 Pharmacokinetics and pharmacogenetics of Gemcitabine as a mainstay in adult and pediatric oncology: an EORTC-PAMM perspective Cancer Chemother Pharmacol. 2016 Jul;78(1):1-12. doi: 10.1007/s00280-016-3003-0.
2 Circulating purine compounds, uric acid, and xanthine oxidase/dehydrogenase relationship in essential hypertension and end stage renal disease. Ren Fail. 2014 May;36(4):613-8. doi: 10.3109/0886022X.2014.882240.
3 Gemcitabine. A review of its pharmacology and clinical potential in non-small cell lung cancer and pancreatic cancer Drugs. 1997 Sep;54(3):447-72. doi: 10.2165/00003495-199754030-00009.
4 DrugBank(Pharmacology-Metabolism):Valacyclovir Hydrochloride

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.