Details of Drug-Metabolizing Enzyme (DME) | INTEDE

General Information of DME (ID: DMEN055)
DME Name	Somatostatin (SST), Homo sapiens
Gene Name	SST
UniProt ID	SMS_HUMAN
EC Number	EC: 4.2.99.18 (Click to Show/Hide the Complete EC Tree) Lyases Carbon-oxygen lyase Other carbon-oxygen lyases EC: 4.2.99.18
Lineage	Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence	MLSCRLQCALAALSIVLALGCVTGAPSDPRLRQFLQKSLAAAAGKQELAKYFLAELLSEP NQTENDALEPEDLSQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
Structure	2MI1 ; 7T10 ; 7WIC ; 7XAT ; 7XMR ; 7XMS ;
Function	[Somatostatin-14]: Inhibits the secretion of pituitary hormones, including that of growth hormone/somatotropin (GH1), PRL, ACTH, luteinizing hormone (LH) and TSH. Also impairs ghrelin- and GnRH-stimulated secretion of GH1 and LH; the inhibition of ghrelin-stimulated secretion of GH1 can be further increased by neuronostatin.

Full List of Drug(s) Metabolized by This DME
Drugs in Phase 3 Clinical Trial			Click to Show/Hide the Full List of Drugs: 1 Drugs
CCG-205124	Drug Info	Phase 3	Psoriasis vulgaris	ICD11: EA90	[1]

Full List of Metabolic Reactions (MR) Catalyzed by This DME

MR ID	Reactant	Product	MR Type	Source Drug	REF
MR000578	CCG-205124	Spermine	Unclear - Unclear	CCG-205124	[1]

References
1	The Association between Spermidine/Spermine N(1)-Acetyltransferase (SSAT) and Human Malignancies Int J Mol Sci. 2022 May 25;23(11):5926. doi: 10.3390/ijms23115926.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.