Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN138) | |||||
---|---|---|---|---|---|
DME Name | GMP reductase (guaC), Bacillus subtilis | ||||
Gene Name | guaC | ||||
UniProt ID | |||||
EC Number | EC: 1.7.1.7 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Bacillus subtilis (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MENVFDYEDIQLIPAKCIVNSRSECDTSVRLGGHTFKLPVVPANMQTIIDEKLAISLAEN
GYFYVMHRFEPETRIDFIKDMNARGLFSSISVGVKDEEYEFVRQLAEENLTPEYVTIDIA HGHSNAVIEMIQHLKKHLPDSFVIAGNVGTPEAVRELENAGADATKVGIGPGKVCITKIK TGFGTGGWQLAALRWCAKAASKPIIADGGIRTHGDIAKSIRFGATMVMIGSLFAGHEESP GQTIEKDGKLYKEYFGSASEFQKGEKKNVEGKKMHVAHKGSIKDTLIEMEQDLQSSISYA GGTKLNAIRNVDYVIVKNSIFNGDKY |
||||
Function | Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides (Probable). | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Xanthine |
Drug Info | Phase 1 | Obstructive sleep apnea | ICD11: 7A41 | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.