Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN272)
DME Name Arylacetamide deacetylase (AADAC), Homo sapiens
Gene Name AADAC
UniProt ID
AAAD_HUMAN
EC Number    EC: 3.1.1.3     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Carboxylic ester hydrolase
EC: 3.1.1.3
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMD
SFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSA
ALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNP
ERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLF
LSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNP
NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTG
VQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Function Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          3 Drugs
Eslicarbazepine acetate
 Drug Info Approved Epilepsy ICD11: 8A60 [1]
Baloxavir marboxil
 Drug Info Approved Influenza virus infection ICD11: 1E30 [2]
Rifapentine
 Drug Info Approved Pulmonary tuberculosis ICD11: 1B10 [3], [4]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR009246 Beclomethasone dipropionate Beclomethasone-17-monopropionate (17-BMP) Hydrolysis - Hydrolysis Beclomethasone dipropionate [5]
MR005746 Rifapentine 25-desacetyl rifapentine Other reaction - Deacylation Rifapentine [3], [4]
References
1 Role of Human Arylacetamide Deacetylase (AADAC) on Hydrolysis of Eslicarbazepine Acetate and Effects of AADAC Genetic Polymorphisms on Hydrolase Activity
2 Pharmacokinetics and safety of a novel influenza treatment (baloxavir marboxil) in Korean subjects compared with Japanese subjects
3 Isoniazid level and flu-like symptoms during rifapentine-based tuberculosis preventive therapy: A population pharmacokinetic analysis. Br J Clin Pharmacol. 2023 Feb;89(2):714-726. doi: 10.1111/bcp.15527.
4 Human arylacetamide deacetylase is responsible for deacetylation of rifamycins: rifampicin, rifabutin, and rifapentine. Biochem Pharmacol. 2011 Dec 1;82(11):1747-56.
5 DrugBank(Pharmacology-Metabolism):Beclomethasone dipropionate

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.