Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN300)
DME Name Elongation of very long chain fatty acids protein 5 (ELOVL5), Homo sapiens
Gene Name ELOVL5
UniProt ID
ELOV5_HUMAN
EC Number    EC: 2.3.1.199     (Click to Show/Hide the Complete EC Tree)
Transferase
Acyltransferase
Acyltransferase
EC: 2.3.1.199
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MEHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPKYMRNKQPFS
CRGILVVYNLGLTLLSLYMFCELVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSK
LIEFMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYFGATLNSFIHVLM
YSYYGLSSVPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWPCTFPLGWLYFQIGYMI
SLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD
Function Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Condensing enzyme that acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. May participate in the production of monounsaturated and of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators (By similarity) . In conditions where the essential linoleic and alpha linoleic fatty acids are lacking it is also involved in the synthesis of Mead acid from oleic acid (By similarity).
Full List of Drug(s) Metabolized by This DME
      Drugs in Phase 4 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Gamma-linolenic acid
 Drug Info Phase 4 Neurodermatitis ICD11: EA83 [1]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Omega-6-FA
 Drug Info Phase 3 Attention deficit hyperactivity disorder ICD11: 6A05 [2]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR007206 Gamma-linolenic acid Dihomo-gamma-linolenic acid Other reaction - Elongation Gamma-linolenic acid [1]
MR006389 Gamma-Linolenic acid Dihomo-gamma-linolenic acid Other reaction - Elongation Omega-6-FA [2]
References
1 Gamma-linolenic acid, Dihommo-gamma linolenic, Eicosanoids and Inflammatory Processes
2 Health implications of high dietary omega-6 polyunsaturated Fatty acids. J Nutr Metab. 2012;2012:539426.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.