Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN389)
DME Name Retinol-binding protein 1 (RBP1), Homo sapiens
Gene Name RBP1
UniProt ID
RET1_HUMAN
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRN
YIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM
RVEGVVCKQVFKKVQ
Structure
5H8T ; 5H9A ; 5HA1 ; 5HBS ; 5LJB ; 5LJC ; 5LJD ; 5LJE ; 5LJG ; 5LJH ; 5LJK ; 6E5L ; 6E5T ; 6E6M
Function Cytoplasmic retinol-binding protein . Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis .
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Beta carotene
 Drug Info Approved Vitamin deficiency ICD11: 5B55 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR005739 Dihydroretinoic acid 9-cis-dihydroretinoic acid Unclear - Unclear Beta carotene [1]
MR005736 Retinal Retinol Unclear - Unclear Beta carotene [1]
References
1 #NAME?

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.