Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN391)
DME Name Retinol-binding protein 4 (RBP4), Homo sapiens
Gene Name RBP4
UniProt ID
RET4_HUMAN
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV
AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND
DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA
RQYRLIVHNGYCDGRSERNLL
Structure
1BRP ; 1BRQ ; 1JYD ; 1JYJ ; 1QAB ; 1RBP ; 1RLB ; 2WQ9 ; 2WQA ; 2WR6 ; 3BSZ ; 3FMZ ; 4O9S ; 4PSQ ; 5NTY ; 5NU2 ; 5NU6 ; 5NU7 ; 5NU8 ; 5NU9 ; 5NUA ; 5NUB ; 6QBA
Function Retinol-binding protein that mediates retinol transport in blood plasma . Delivers retinol from the liver stores to the peripheral tissues (Probable). Transfers the bound all-trans retinol to STRA6, that then facilitates retinol transport across the cell membrane .
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Beta carotene
 Drug Info Approved Vitamin deficiency ICD11: 5B55 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR005736 Retinal Retinol Unclear - Unclear Beta carotene [1]
References
1 #NAME?

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.