Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN738)
DME Name Valacyclovir hydrolase (BPHL), Homo sapiens
Gene Name BPHL
UniProt ID
BPHL_HUMAN
EC Number    EC: 3.1.-.-     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Ester bond hydrolase
Ester bond hydrolase
EC: 3.1.-.-
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MVAVLGGRGVLRLRLLLSALKPGIHVPRAGPAAAFGTSVTSAKVAVNGVQLHYQQTGEGD
HAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKD
AVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIR
DVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVH
GEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Structure
2OCG ; 2OCI ; 2OCK ; 2OCL
Function Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          4 Drugs
Valaciclovir
 Drug Info Approved Virus infection ICD11: 1A24-1D9Z [1]
Valacyclovir Hydrochloride
 Drug Info Approved Herpes simplex virus infection ICD11: 1F00 [1]
Valganciclovir
 Drug Info Approved Virus infection ICD11: 1A24-1D9Z [2]
Valganciclovir
 Drug Info Approved Virus infection ICD11: 1A24-1D9Z [3]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR013483 Valaciclovir Acyclovir Unclear - Unclear Valacyclovir Hydrochloride [4], [1]
MR013484 Valaciclovir L-valine Unclear - Unclear Valacyclovir Hydrochloride [4], [1]
References
1 Human valacyclovir hydrolase/biphenyl hydrolase-like protein is a highly efficient homocysteine thiolactonase
2 Identification of a human valacyclovirase: biphenyl hydrolase-like protein as valacyclovir hydrolase
3 Specificity of a prodrug-activating enzyme hVACVase: the leaving group effect
4 Valacyclovir: a review of its antiviral activity, pharmacokinetic properties, and clinical efficacy

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.