Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN848) | |||||
|---|---|---|---|---|---|
| DME Name | beta-lactamase CTX-M-1 (bla), Escherichia coli | ||||
| Gene Name | bla | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Escherichia coli (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ
ILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTM SLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGS GDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL |
||||
| Structure | |||||
| Function | Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ceftazidime |
Drug Info | Approved | Bacterial infection | ICD11: 1A00-1C4Z | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Antagonism between substitutions in -lactamase explains a path not taken in the evolution of bacterial drug resistance | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.