Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1031) | |||||
---|---|---|---|---|---|
DME Name | Chloramphenicolase (chlR), Proteus penneri | ||||
Synonyms | Chloramphenicol reductase; Enzyme chloramphenicolase; Reductase chloramphenicol | ||||
Gene Name | chlR | ||||
UniProt ID | |||||
EC Number | EC: 2.3.1.28 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Proteus penneri (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKKIDLNSWNRREHFAFFSQFDEPFFSIVAEVDCTVAYRKAKEQDIPFFIWYLYQSLLAA
NQVEPFRYRIIDNEVVVLDEIHASSTVAREDHTFGFTFMPYREDIKAFVAEALPEIERVQ QLEGLCFDEKTSRTDVIHYSSIPWINFTALTHARHNARKDSVPKISFGQYQEKEGKLMMP VSVTVHHGLMDGYHVGLFLTKFQKLLES |
||||
Function | This enzyme catalyzes the hydrolysis of the amide bond in chloramphenicol. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Chloramphenicol |
Drug Info | Approved | Conjunctivitis | ICD11: 9A60 | [1] |
References | |||||
---|---|---|---|---|---|
1 | The bacterial degradation of chloramphenico. Lancet. 1967 Jun 10;1(7502):1259-60. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.