Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1054) | |||||
---|---|---|---|---|---|
DME Name | L-arabinose isomerase (araA), Clostridium hylemonae | ||||
Synonyms | Isomerase L-arabinose; D-arabinose aldose-ketose-isomerase; araA; CLOHYLEM_05792; LAJLEIBI_03201 | ||||
Gene Name | araA | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 5.3.1.4 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Clostridium hylemonae (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MIKSKEYKFWFCTGSQDLYGEECLAHVAEHSRRIVEALNASGALPYEVVWKPTLITNELI
RKTFNEANTDETCAGVITWMHTFSPAKSWILGLQEYRKPLLHLHTQFNEEIPYDTIDMDF MNENQAAHGDREYGHIFSRLRMERKVVAGYWADPKVQKKIGSWMRTAVGVIESSHVRVMR IADNMRNVAVTEGDKVEAQIKFGWEVDTYPVNEIAEAVAEVSKSDIGTLVEEYYDKYDIL LEGRDEKEFREHVAVQAGIEIGFERFLEERDYQAIVTHFGDLGSLKQLPGLAIQRLMEKG YGFGGEGDWKTAAMVRIMKIMTEGVKDARGTSFMEDYTYNLIPGKEGILQAHMLEVCPSV AEGPISIKCQPLTMGDREDPARLVFTSKEGPAVAASLIDLGDRFRLIINDVDCKKTEKPM PKLPVATAFWTPQPDLQTGAEAWILAGGAHHTAFSYDLSAGQLGDWADAMGIEAVYIDKN TEIRQFKNELRWNAAAYKLGI |
||||
Function | This enzyme catalyzes the conversion of L-arabinose to L-ribulose. It requires a divalent metal ion and binds the closed form of the sugar and catalyses ring opening to generate a form of open-chain conformation that facilitates the isomerization reaction, which proceeds via an ene-diol mechanism. It can also convert D-galactose to D-tagatose with lower efficiency. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
CERC-801 |
Drug Info | Phase 2 | Glycosylation disorder | ICD11: 5C54 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Biochemical properties of L-arabinose isomerase from Clostridium hylemonae to produce D-tagatose as a functional sweetener. PLoS One. 2018 Apr 23;13(4):e0196099. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.