Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1142) | |||||
---|---|---|---|---|---|
DME Name | Aminoglycoside O-phosphotransferase (aphA6), Providencia stuartii | ||||
Synonyms | Aminoglycoside 3'-phosphotransferase; Kanamycin kinase, type VI; Neomycin-kanamycin phosphotransferase type VI; APH(3')VI; AphA6; aphA-6; aphA6 | ||||
Gene Name | aphA6 | ||||
UniProt ID | |||||
EC Number | EC: 2.7.1.95 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Providencia stuartii (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
GNSVLEPNKIGQSPSDVYSFNRNNETFFLKRSSTLYTETTYSVSREAKMLSWLSDKLKVP
ELIMTFQDEQFEFMITKAINAKPISALFLTEQELLAIYKETLNQLNAVAIIDCPFISSID HRLKESKFFIDNQLLDEIDQDDLDAELWGDHKTYISLWNELNETRVEERLVFSHGDITDS NIFIDKSGEIYFLDLGRAGLADEFVDISFVERCLREDVSEETAKIFLKHLKNDRPDKR |
||||
Function | This enzyme acts on the antibiotics neomycin, paromomycin, neamine, paromamine, vistamycin and gentamicin A. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Plazomicin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Plazomicin retains antibiotic activity against most aminoglycoside modifying enzymes. ACS Infect Dis. 2018 Jun 8;4(6):980-987. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.