Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1247) | |||||
---|---|---|---|---|---|
DME Name | Nitroreductase (NTR), Enterobacter cloacae | ||||
Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; nfsB; nfsI | ||||
Gene Name | nfsB | ||||
UniProt ID | |||||
EC Number | EC: 1.5.1.39 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Enterobacter cloacae (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MDIISVALKRHSTKAFDASKKLTAEEAEKIKTLLQYSPSSTNSQPWHFIVASTEEGKARV
AKSAAGTYVFNERKMLDASHVVVFCAKTAMDDAWLERVVDQEEADGRFNTPEAKAANHKG RTYFADMHRVDLKDDDQWMAKQVYLNVGNFLLGVGAMGLDAVPIEGFDAAILDEEFGLKE KGFTSLVVVPVGHHSVEDFNATLPKSRLPLSTIVTEC |
||||
Structure | |||||
Function | This enzyme uses NADH as source of reducing equivalents to reduce of a variety of nitroaromatic compounds. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 3 Drugs | ||||
Metronidazole |
Drug Info | Approved | Amebiasis | ICD11: 1A36 | [1] |
Secnidazole |
Drug Info | Approved | Amebiasis | ICD11: 1A36 | [1] |
Tinidazole |
Drug Info | Approved | Protozoan infection | ICD11: 1F5Z | [1] |
Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
AI3-23606 |
Drug Info | Phase 1 | Trypanosomiasis | ICD11: 1F51 | [1] |
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Quinone |
Drug Info | Investigative | Prostate cancer | ICD11: 2C82 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Overexpression, isotopic labeling, and spectral characterization of Enterobacter cloacae nitroreductase. Protein Expr Purif. 1998 Jun;13(1):53-60. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.