Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1312) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Burkholderia cenocepacia | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; penB1; blaA; F01_480029 | ||||
Gene Name | penB1 | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Burkholderia cenocepacia (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human lung. | ||||
Sequence |
MTYSSKRRTLLLAAATAPLVLTATACASRQAAAPDPATAAAAAAADAMAPAAAAATLADL
ERDAGGRLGVCAIDTASGRVIEHRAGERFPFCSTFKAMLSAAVLAQSVERPGLLQQRVKY TKADLVNYSPVSEKHVGAGMTVAALCEATIQYSDNSAANLLMKLIGGPSAVTAYARSIGD DAFRLDRWETELNTALPGDPRDTTTPAAMAASIRVLTLGDALPAAQRAQLVAWLRGNKVG DKRIRAGVPAGWTVGDKTGTGDYGTTNDAGVIWPTSRAPIVLAVYYTQTRADARAKDDVI ASVARIVAQTFG |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Cefotaxime |
Drug Info | Approved | Meningitis | ICD11: 1A62 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Cell wall recycling-linked coregulation of AmpC and PenB beta-lactamases through ampD mutations in Burkholderia cenocepacia. Antimicrob Agents Chemother. 2015 Dec;59(12):7602-10. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.