Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1731) | |||||
---|---|---|---|---|---|
DME Name | Carbapenemase (cphA), Aeromonas hydrophila | ||||
Synonyms | Versatile beta-lactamase; Versatile hydrolytic beta-lactamase; Beta-lactamase II; Carbapenem-hydrolyzing metallo-beta-lactamase; Metallo-beta-lactamase type 2b; Metallo-beta-lactamase type IIb; cphA | ||||
Gene Name | cphA | ||||
UniProt ID | |||||
EC Number | EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Aeromonas hydrophila (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MMKGWMKCGLAGAVVLMASFWGGSVRAAGMSLTQVSGPVYVVEDNYYVQENSMVYFGAKG
VTVVGATWTPDTARELHKLIKRVSRKPVLEVINTNYHTDRAGGNAYWKSIGAKVVSTRQT RDLMKSDWAEIVAFTRKGLPEYPDLPLVLPNVVHDGDFTLQEGKVRAFYAGPAHTPDGIF VYFPDEQVLYGNCILKEKLGNLSFADVKAYPQTLERLKAMKLPIKTVIGGHDSPLHGPEL IDHYEALIKAAPQS |
||||
Structure | |||||
Function | This enzyme confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. It is able to hydrolyze penicillin and imipenem, but is much less active against cephalothin, cefotaxime, meropenem and ceftazidime. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Meropenem |
Drug Info | Approved | Pseudomonas infection | ICD11: 1G40 | [1], [2] |
Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Imipenem |
Drug Info | Phase 4 | Acute pancreatitis | ICD11: DC31 | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.