Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DMEN163) | |||||
---|---|---|---|---|---|
DME Name | NAD-dependent protein deacetylase HST2 (HST2), Saccharomyces cerevisiae | ||||
Gene Name | HST2 | ||||
UniProt ID | |||||
EC Number | EC: 2.3.1.286 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Saccharomyces cerevisiae (Click to Show/Hide the Complete Species Lineage) | ||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Sequence |
MSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKL
PYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTL ERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPA IVFFGEDLPDSFSETWLNDSEWLREKITTSGKHPQQPLVIVVGTSLAVYPFASLPEEIPR KVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTAQGGMGDN SKEQLLEIVHDLENLSLDQSEHESADKKDKKLQRLNGHDSDEDGASNSSSSQKAAKE |
||||
Structure | |||||
Function | NAD-dependent histone deacetylase that is involved in nuclear silencing events. Derepresses subtelomeric silencing and increases repression in nucleolar (rDNA) silencing. Its function is negatively regulated by active nuclear export. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
D-ribosylnicotinate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
References | |||||
---|---|---|---|---|---|
1 | Nicotinamide riboside and nicotinic acid riboside salvage in fungi and mammals. Quantitative basis for Urh1 and purine nucleoside phosphorylase function in NAD+ metabolism |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.