Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1072) | |||||
|---|---|---|---|---|---|
| DME Name | Cytochrome P450 MEG (cyp106), Bacillus megaterium | ||||
| Synonyms | Steroid 15-beta-hydroxylase; Steroid 15-beta-monooxygenase; Cytochrome P450(MEG); P450(MEG); cyp106A2 | ||||
| Gene Name | cyp106A2 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.15.8 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bacillus megaterium (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKEVIAVKEITRFKTRTEEFSPYAWCKRMLENDPVSYHEGTDTWNVFKYEDVKRVLSDYK
HFSSVRKRTTISVGTDSEEGSVPEKIQITESDPPDHRKRRSLLAAAFTPRSLQNWEPRIQ EIADELIGQMDGGTEIDIVASLASPLPIIVMADLMGVPSKDRLLFKKWVDTLFLPFDREK QEEVDKLKQVAAKEYYQYLYPIVVQKRLNPADDIISDLLKSEVDGEMFTDDEVVRTTMLI LGAGVETTSHLLANSFYSLLYDDKEVYQELHENLDLVPQAVEEMLRFRFNLIKLDRTVKE DNDLLGVELKEGDSVVVWMSAANMDEEMFEDPFTLNIHRPNNKKHLTFGNGPHFCLGAPL ARLEAKIALTAFLKKFKHIEAVPSFQLEENLTDSATGQTLTSLPLKASRM |
||||
| Structure | |||||
| Function | This enzyme has the capacity to hydroxylate certain steroids in the 15-beta position, and it also hydroxylates progesterone in the 11-alpha and 9-beta position. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Progesterone |
Drug Info | Approved | Premature labour | ICD11: JB00 | [1] |
Testosterone cypionate |
Drug Info | Approved | Testosterone deficiency | ICD11: 5A81 | [2], [3] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

