Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1076)
DME Name Nicotinamidase (pncA), Acinetobacter baumannii
Synonyms Nicotinamide deamidase; Pyrazinamidase; Bifunctional protein; NAMase; PZAase; ABAYE0059; pncA
Gene Name pncA
UniProt ID
B0VA03_ACIBY
EC Number    EC: 3.5.1.19     (Click to Show/Hide the Complete EC Tree)
Hydrolases
Carbon-nitrogen hydrolase
Linear amide hydrolase
EC: 3.5.1.19
Lineage    Species: Acinetobacter baumannii     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Moraxellaceae
Genus: Acinetobacter
Species: Acinetobacter baumannii
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human lung.
Sequence
MKMNKQPQNSALVVVDVQNGFTPGGNLAVADADTIIPTINQLAGCFENVVLTQDWHPDNH
ISFAANHPGKQPFETIELDYGSQVLWPKHCIQGTHDAEFHPDLNIPTAQLIIRKGFHAHI
DSYSAFMEADHTTMTGLTGYLKERGIDTVYVVGIATDFCVAWTALDAVKQGFKTLVIEDA
CKGIDLNGSLEQAWQTMQQQGVVRIQSTDLLNEC
Structure
2WT9 ; 2WTA
Pathway Metabolic pathways (aby01100 )
Nicotinate and nicotinamide metabolism (aby00760 )
Function This enzyme acts on carbon-nitrogen bonds and takes part in nicotinate and nicotinamide metabolism.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Pyrazinamide
 Drug Info Approved Pulmonary tuberculosis ICD11: 1B10 [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR002200 5-hydroxypyrazinamide 5-hydroxypyrazinoic acid Unclear - Unclear Pyrazinamide [2], [3], [4]
MR002201 Pyrazinamide Pyrazinoic acid Oxidation - Oxidation Pyrazinamide [2], [3], [4]
References
1 Specificity and mechanism of Acinetobacter baumanii nicotinamidase: implications for activation of the front-line tuberculosis drug pyrazinamide. Angew Chem Int Ed Engl. 2009;48(48):9176-9.
2 Factors Affecting the Pharmacokinetics of Pyrazinamide and Its Metabolites in Patients Coinfected with HIV and Implications for Individualized Dosing Antimicrob Agents Chemother. 2021 Jun 17;65(7):e0004621. doi: 10.1128/AAC.00046-21.
3 Metabolism and Hepatotoxicity of Pyrazinamide, an Antituberculosis Drug Drug Metab Dispos. 2021 Aug;49(8):679-682. doi: 10.1124/dmd.121.000389.
4 Determination of pyrazinamide and its main metabolites in rat urine by high-performance liquid chromatography J Chromatogr B Biomed Sci Appl. 1997 Aug 1;695(2):365-72. doi: 10.1016/s0378-4347(97)00175-8.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.