Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1138) | |||||
|---|---|---|---|---|---|
| DME Name | Alpha-glucosidase (aglA), Blautia obeum | ||||
| Synonyms | Oligo-1,6-glucosidase; 6-phospho-alpha-glucosidase 1; DW040_17105; ERS852394_00764; malL_1 | ||||
| Gene Name | malL_1 | ||||
| UniProt ID | |||||
| Gene ID | |||||
| EC Number | EC: 3.2.1.20 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Blautia obeum (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MEKKWWKESVVYQIYPKSFKDSNGDGVGDIRGIIQKLDYLKELGVNVLWISPMLESPQDD
NGYDISDYRRIYKEYGTMEDYEELLSEAHKRDIRILMDLVVNHTSDEHNWFIESRKSKDN PYRDYYIWKDPVNGKEPNNWGGVFGGSAWEYDAQTQMYYLHLFSKKQPDLNWENEKVRQE VYDMMTFWCEKGIDGFRMDVISMISKDQAFPDGKMNNSLYGDFGPYCVHGPRIHEFLQEM NREVLSRYDIMTVGETSGVTIEEAQKYAGEAGKELNMVFQFEHVDNGSGDYGKWTTEKYD FKEFKRIMIKWQEELQGKAWNSLFLGNHDQPRSVSRFGNDNPAYRETSAKMLATCLHMMQ GTPYVYQGEELGMTNVYFDKLEDYRDIESINFFTELTESGLMTPEYMMKCLMLRSRDNAR TPMQWDDSEQAGFTDGESWIKVNPNYKEINAAQQLKDPNSIFHYYQKLISLRKEKDIIVY GEFEPLYRDDEQIFAYTRKLDQEKLLTVCNFSDKNAEMEIPEEFKGAECLITNLDRTVFE GKIVLKPYEAFVLYKK |
||||
| Function | This enzyme is probably involved in the catabolism of alpha-glycosides accumulated via a phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). And it hydrolyzes a wide variety of 6-phospho-alpha-D-glucosides including the five isomeric derivatives of sucrose, i.e. trehalulose-6'-phosphate, turanose-6'-phosphate, maltulose-6'-phosphate, leucrose-6'-phosphate, and palatinose-6'-phosphate, but is not active on sucrose-6-phosphate. Moreover, it can also hydrolyze maltose-6'-phosphate and methyl-alpha-glucose-6-phosphate, and poorly, trehalose-6-phosphate. However, it fails to hydrolyze beta-O-linked phosphorylated disaccharides such as cellobiose-6'-phosphate and gentiobiose-6'-phosphate. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
M-7403 |
Drug Info | Phase 1/2 | Prostate cancer | ICD11: 2C82 | [1] |
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Isomaltose |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Novel alpha-glucosidase from human gut microbiome: substrate specificities and their switch. FASEB J. 2010 Oct;24(10):3939-49. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

