Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1199) | |||||
|---|---|---|---|---|---|
| DME Name | L,D-carboxypeptidase A (ldcA), Neisseria gonorrhoeae | ||||
| Synonyms | Carboxypeptidase; LD-carboxypeptidase; Murein tetrapeptide carboxypeptidase; VT05_01038; ldcA | ||||
| Gene Name | ldcA | ||||
| UniProt ID | |||||
| EC Number | EC: 3.4.17.13 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Neisseria gonorrhoeae (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MTEPTSRRRFLKTCTAAGAGLLQACGTSATSVPPLPSSHSVVKARTVPLQTPRRQSSDGN
LLRVVASSGFAEDTNRVNTALTRLYNAGFTVTNQQAGSRRFQRFAGTDAQRAADFQEVAS GRVATPKVLMGLRGGYGAARILPHIDFASLGARMREHGTLFFGFSDVCAVQLALLAKGNM MSFAGPMAYSDFGKPAPGAFTMDAFIKGATQNRLTVDVPYIQRTDVETEGTLWGGNLSVL ASLAGTPYMPDIDGGILFLEDVGEQPYRIERMLNTLYLSGILGKQRAIVFGDFRMEKIRD LYDSSYDFSAVAKHISRTAKIPVLTGFPFGHIADKITFPLGAHTRIRMNGNGGYSVAFEG YPTLDASALTLDTLLPPPDLPIFPESGVADISE |
||||
| Function | This enzyme hydrolyzes peptide bonds of C-terminal residues with aromatic or aliphatic side-chains. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Dithiazoline |
Drug Info | Investigative | Gonococcal infection | ICD11: 1A70 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Selective inhibition of Neisseria gonorrhoeae by a dithiazoline in mixed infections with Lactobacillus gasseri. Antimicrob Agents Chemother. 2018 Nov 26;62(12). pii: e00826-18. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

