Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1466) | |||||
|---|---|---|---|---|---|
| DME Name | Cytochrome P450 154C2 (cyp154), Streptomyces avermitilis | ||||
| Synonyms | Cytochrome P450 family 154 subfamily C member 2; Cytochrome cyp154C2; P450 154C2; cyp154C2 | ||||
| Gene Name | cyp154C4-2 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.14.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Streptomyces avermitilis (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MTRIALDPFVRDLDGESAALRAAGPLAEVELPGGVHVYAVTHHKEARALLTDSRVVKDIN
VWNAWQRGEIPADWPLIGLVNPGRSMLTVDGPDHRRLRTLVAQALTVKRVEKLRAGIEAL TNASLERLAALPAGEPVDLKAEFAYPLPMNVISELMGVDAADHPRLKELFEKFFSTQTPP EEVPQMMADLGTLFTKIVEEKKANPGDDLTSALIAASEDGDHLTDEEILNTLQLIIAAGH ETTISLIVNVVEALAIHPEQRKKVLSGEIPWEGVIEETLRWNTPTSHVLIRFATEDIEVG DKVLPKGEGLVVSFGALGRDEEQYGPTAGDFDATRTPNRHIAFGHGPHVCPGAALSRLEA GIALPALYERFPELDLAVPAAELRNKPIVTQNDLHDLPVKLGCPFGHDA |
||||
| Function | This enzyme is P-450 heme-thiolate protein, acting on a wide range of substrates including many xenobiotics, steroids, fatty acids, vitamins and prostaglandins; reactions catalysed include hydroxylation, epoxidation, N-oxidation, sulfooxidation, N-, S- and O-dealkylations, desulfation, deamination, and reduction of azo, nitro and N-oxide groups. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Testosterone cypionate |
Drug Info | Approved | Testosterone deficiency | ICD11: 5A81 | [1], [2] |
| Experimental Enzyme Kinetic Data of Drugs | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Testosterone cypionate |
Drug Info | Approved | Testosterone deficiency | Km = 160 microM | [1], [2] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

