Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1476) | |||||
---|---|---|---|---|---|
DME Name | Azoreductase (azoR), Streptococcus pyogenes | ||||
Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; Flavin reductase; NAD(P)H-dependent oxidoreductase; NADPH azoreductase; azoR; A6J87_06095; CKU37_01320; CQA85_07565; D8867_01950; DL07_01170; DWV94_10025; DWY30_01550; DWZ07_06240; FBF48_06605; NCTC8618_04344; azr_2; azr_4 | ||||
Gene Name | azr_2 | ||||
UniProt ID | |||||
Gene ID | |||||
EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Streptococcus pyogenes (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MKFVGLVGANYDQSYNRKLLEFIRRHFKIKFELEVLEIDEVPMFNQDEKWDESFQLRLLN
NKITRADGVIIATPEHNHTISAALKSVLEWLSFEVHPFENKPVMIVGASYYDQGTSRAQV HLRKILEAPGVNAYTLPGNEFLLGKAKEAFDLEGNITNEGTINFLEQCLDNFIQYVGVVS KLKKPKPIEPEDLDCNNPIATTVTEVDPDDPEWVEKVAEITGAVSGDTYVKLDHGILTVN QIDMFLKAMPFELTYADDNNQFLYYNNAHQDPDTMFAKRVPPQSGSRMSTVHGSLPPARM KNVEWVIGTLRNGNQEYVRTIVPGSPEGVINTHNYQAMYYDDGSYAGINEIVFNFKPWLD WYLETTGQRLVGGSGPFAPAAASHGGSDATSGASDAGGHGGDAAPAADATSGASSY |
||||
Function | This enzyme catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Prontosil |
Drug Info | Investigative | Pseudomonas infection | ICD11: 1G40 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Intestinal azo-reduction and glucuronide conjugation of prontosil. Xenobiotica. 1973 Sep;3(9):599-604. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.