Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1615) | |||||
|---|---|---|---|---|---|
| DME Name | Naphthalene dioxygenase (doxB), Pseudomonas furukawaii | ||||
| Synonyms | Naphthalene 1,2-dioxygenase ISP alpha; Naphthalene 1,2-dioxygenase subunit alpha; Naphthalene 1,2-dioxygenase system large oxygenase component; ISP NAP; ND subunit alpha; NDO subunit alpha; doxB | ||||
| Gene Name | doxB | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.12.12 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Pseudomonas furukawaii (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MNYNNKILVSESGLSQKHLIHGDEELFQHELKTIFARNWLFLTHDSLIPAPGDYVTAKMG
IDEVIVSRQNDGSIRAFLNVCRHRGKTLVSVEAGNAKGFVCSYHGWGFGSNGELQSVPFE KDLYGESLNKKCLGLKEVARVESFHGFIYGCFDQEAPPLMDYLGDAAWYLEPMFKHSGGL ELVGPPGKVVIKANWKAPAENFVGDAYHVGWTHASSLRSGESIFSSLAGNAALPPEGAGL QMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGDVRARIYRSHLNCTV FPNNSMLTCSGVFKVWNPIDANTTEVWTYAIVEKDMPEDLKRRLADSVQRTFGPAGFWES DDNDNMETASQNGKKYQSRDSDLLSNLGFGEDVYGDAVYPGVVGKSAIGETSYRGFYRAY QAHVSSSNWAEFEHASSTWHTELTKTTDR |
||||
| Structure | |||||
| Function | This enzyme is a member of the ring-hydroxylating dioxygenase (RHD) family of bacterial enzymes that play a critical role in the degradation of aromatic compounds, such as polycyclic aromatic hydrocarbons, and it requires Fe2+. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Naproxen |
Drug Info | Approved | Rheumatoid arthritis | ICD11: FA20 | [1] |
| Drugs in Phase 4 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Isoflavone |
Drug Info | Phase 4 | Asthma | ICD11: CA23 | [2] |
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Flavone |
Drug Info | Investigative | Colon cancer | ICD11: 2B90 | [2] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

