Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1864) | |||||
---|---|---|---|---|---|
DME Name | Flavin adenine dinucleotide dehydrogenase (fadd), Clostridium leptum | ||||
Synonyms | FAD pyrophosphorylase; FAD synthase; FMN adenylyltransferase | ||||
Gene Name | apbE1 | ||||
UniProt ID | |||||
EC Number | EC: 1.5.1.37 (Click to Show/Hide the Complete EC Tree) | ||||
Lineage | Species: Clostridium leptum (Click to Show/Hide the Complete Species Lineage) | ||||
Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human gut. | ||||
Sequence |
MDMTFFRAALLGACVLLSGCDSATTPASPASTATVLDGKTMGTFWRVSVIGVDEAKAEAL
RAKVQAQLDADDRLLSTWKNDSALMRFNHAADTRPWPVSEAMVDIVTLSLRIGAKTHGAM DITVGPLVNLWGFGPDKQPVTTPDAQAIAAAKARTGLQHLQVINQSGRQFLQKDIPDLFV DLSTVGEGYAADHLARLMEQEGISRYLVSVGGALVSRGMNGEGKPWRVAIQKPTDRENAV QAIVDINGHGISTSGSYRNYYELDGKRISHVIDPQTGQPITHKLVSVTVIAPTALEADGW DTGLMVLGPEKAQQVVREQGLAVYMIVKEGEGFKTWMSPQFRTFLVGEKN |
||||
Function | This enzyme can reduce either FAD or flavin mononucleotide (FMN) but prefers FAD. But it can not reduce riboflavin and does not use NADPH as acceptor. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs in Phase 3 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
RO-7-0207 |
Drug Info | Phase 3 | Colon cancer | ICD11: 2B90 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Reduction of azo dyes and nitroaromatic compounds by bacterial enzymes from the human intestinal tract. Environ Health Perspect. 1995 Jun;103 Suppl 5:17-9. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.