Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1949) | |||||
|---|---|---|---|---|---|
| DME Name | Arginine dihydrolase (arcA), Staphylococcus petrasii | ||||
| Synonyms | Arginine deiminase; arcA; AD; ADI; BJR09_08810; E2557_01300; NCTC13830_00349 | ||||
| Gene Name | arcA | ||||
| UniProt ID | |||||
| EC Number | EC: 3.5.3.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Staphylococcus petrasii (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human blood. | ||||
| Sequence |
MTQGPIQVNSEIGKLKTVLLKRPGKELENLVPDHLSGLLFDDIPYLKVAQEEHDKFAQTL
RDEGVEVVYLEKLAAEAIADKAVREQFIDDILAESQKTILGHEEEIKKFFETLSDQELID KIMAGVRKEEIELETTHLVEYLDDRYPFYLDPMPNLYFTRDPQASVGRGMTINRMYWRAR RRESLFITYILKHHPRFKDADVPVWLDRNSPFNIEGGDELILSKEALAIGISERTSAQAI ERLARNIFKDESTTFKKVIAIEIPNSRSFMHLDTVFTMIDYDKFTVHSAIFKEENNMNIF TIEYDEAKDDIKITHSHKLRETLADVLGVDHIDFIPTGNGDVIDGAREQWNDGSNTLCIR PGVVVTYDRNYVSNQLLRDKGIKVIEITGSELVRGRGGPRCMSQPLFREDI |
||||
| Function | This enzyme acts on canavanine. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
L-arginine |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Staphylococcus jettensis sp. nov., a coagulase-negative staphylococcal species isolated from human clinical specimens. Int J Syst Evol Microbiol. 2013 Sep;63(Pt 9):3250-6. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.