Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1968)
DME Name Nitroreductase (NTR), Salmonella typhimurium
Synonyms FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; AAK29_19565; AAP89_17340; ABO94_21460; AF480_20870; AF488_23150; AF489_23340; AIC76_20195; AU613_12225; AXR84_20760; AXU58_04975; C2253_16765; CD48_22070; CE87_20375; CET98_22760; CQG18_18555; CVR97_26810; D4369_19420; D4380_20855; D4401_19160; D4E62_20230; D6360_18430; D7F20_19765; D7H43_20545; DJ388_15780; DKJ11_20120; DKU57_16540; DLM31_17395; DNV30_18555; DO698_18905; DOJ90_20570; DOQ88_18330; DPJ93_20300; DQ848_17880; DRM14_15155; DSF69_18065; DSR36_20995; DUW48_14845; EBO41_17185; EBP31_19365; EGU67_18695; EHB24_16995; EHC98_18885; EIW53_20245; GW08_19510; LZ63_23085; NG18_18155; NU83_21515; QA89_14925; QB40_21055; QD15_17380; RJ78_20865; SAMEA4398682_04794; SBOV39431; Y934_22205; YG50_14570; YI33_18440; YR17_18395; ZA53_16690; ZB89_19155
Gene Name yieF
UniProt ID
A0A5K1UB29_SALTM
EC Number    EC: 1.5.1.39     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-NH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.5.1.39
Lineage    Species: Salmonella typhimurium     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella typhimurium
Subspecies: Salmonella typhimurium subsp. enterica serovar Typhimurium
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MKKGARMSETLNVVTLLGSLRKGSFNGMVARTLPKVAPAGMTVSPLPSIGDIPLYDADIQ
QEEGFPASVEALAEQIRNADGVVIVTPEYNYSVPGGLKNAIDWLSRLPEQPLAGKPVLIQ
TSSMGAIGGARCQYHLRQILVFLDAMVMNKPEFMGGVIQNKVDPQTGEVVDQGTLDHLTG
QLTAFGEFIQRVKA
Function This enzyme catalyzes the reduction of a variety of nitroaromatic compounds.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          2 Drugs
Niclosamide
 Drug Info Approved Tapeworm infestation ICD11: 1F7Y [1]
Riboflavin
 Drug Info Approved Acne vulgaris ICD11: ED80 [2], [3]
      Drugs in Phase 3 Clinical Trial Click to Show/Hide the Full List of Drugs:          1 Drugs
Nitrazepam
 Drug Info Phase 3 Insomnia ICD11: 7A00 [2], [3]
      Preclinical/investigative Agents Click to Show/Hide the Full List of Drugs:          2 Drugs
Mononitrophenol
 Drug Info Investigative Discovery agent ICD: N.A. [2], [3]
Nitrobenzoate
 Drug Info Investigative Discovery agent ICD: N.A. [2], [3]
References
1 CYP1A1 and Cnr nitroreductase bioactivated niclosamide in vitro. Mutagenesis. 2013 Nov;28(6):645-51.
2 Purification and characterization of wild-type and mutant "classical" nitroreductases of Salmonella typhimurium. L33R mutation greatly diminishes binding of FMN to the nitroreductase of S. typhimurium. J Biol Chem. 1998 Sep 11;273(37):23922-8.
3 Prenatal diagnosis of junctional epidermolysis bullosa Herlitz type. Lancet. 1989 Oct 28;2(8670):1035-6. Letter

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.