Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN098) | |||||
|---|---|---|---|---|---|
| DME Name | Cytochrome P450 2C70 (Cyp2c70), Mus musculus | ||||
| Gene Name | Cyp2c70 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.14.- (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Mus musculus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Expressed in liver. . | ||||
| Sequence |
MALFIFLGIWLSCFLFLFLWNQHRGRGKLPPGPTPLPIVGNILQVDVKNISKSMGMLAKK
YGPVFTVYLGMKPTVVLHGYKAMKEALIDQGDEFSDKTDSSLLSRTSQGLGIVFSNGETW KQTRRFSLMVLRSMGMGKKTIEDRIQEEILYMLDALRKTNGSPCDPSFLLACVPCNVIST VIFQHRFDYNDQTFQDFMENFHRKIEILASPWSQLCSAYPILYYLPGIHNRFLKDVTQQK KFILEEINRHQKSLDLSNPQDFIDYFLIKMEKEKHNQKSEFTMDNLVVSIGDLFGAGTET TSSTVKYGLLLLLKYPEVTAKIQEEIAHVIGRHRRPTMQDRNHMPYTDAVLHEIQRYIDF VPIPSPRKTTQDVEFRGYHIPKGTSVMACLTSVLNDDKEFPNPEKFDPGHFLDEKGNFKK SDYFVAFSAGRRACIGEGLARMEMFLILTNILQHFTLKPLVKPEDIDTKPVQTGLLHVPP PFELCFIPV |
||||
| Function | A cytochrome P450 monooxygenase involved in muricholic acid (MCA) synthesis . Hydroxylates at the 6-beta position two major bile acids, chenodeoxycholic acid (CDCA) and ursodeoxycholic acid (UDCA) to form alpha-MCA and beta-MCA, respectively . May regulate NR1H4/farnesoid X receptor signaling, as taurine-conjugated MCAs are antagonists of NR1H4. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase) . | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 1 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Bile acid |
Drug Info | Phase 1 | Inflammatory bowel disease | ICD11: DD72 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Bile Acid Metabolism in Liver Pathobiology | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

