Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN175) | |||||
|---|---|---|---|---|---|
| DME Name | Mevalonate-3-phosphate 5-kinase (Ta0762), Thermoplasma acidophilum | ||||
| Gene Name | Ta0762 | ||||
| UniProt ID | |||||
| EC Number | EC: 2.7.1.186 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Thermoplasma acidophilum (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MNSRIMFIGGVPGVGKTSISGYIARNTDIDIVLSSDYLREFLRPFAPQESHLETSVYDAW
KFYGDMSDDNIIRGYLDQARPIMGGINRVIARALANGEDLIIESLYFVPDMMDEMVLKNA FLAYVYIDDPDLHRSRLEDRINYTHRNSPGSRLAAHLKEYRTIMDYSMDMARGRGIGLYS TDDYALARQRLLDDFRKFVDRR |
||||
| Function | Phosphorylates mevalonate 3-phosphate to form mevalonate 3,5-bisphosphate. Functions in an alternative mevalonate pathway, only present in extreme acidophiles of the Thermoplasmatales order, which passes through mevalonate 3-phosphate rather than mevalonate 5-phosphate. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Mevalonate |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Evidence of a novel mevalonate pathway in archaea | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.