Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN308) | |||||
|---|---|---|---|---|---|
| DME Name | Putative NAD(P)H nitroreductase YfkO (yfkO), Bacillus subtilis | ||||
| Gene Name | yfkO | ||||
| UniProt ID | |||||
| EC Number | EC: 1.-.-.- (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bacillus subtilis (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MADLKTQILDAYNFRHATKEFDPNKKVSDSDFEFILETGRLSPSSLGLEPWKFVVVQNPE
FREKLREYTWGAQKQLPTASHFVLILARTAKDIKYNADYIKRHLKEVKQMPQDVYEGYLS KTEEFQKNDLHLLESDRTLFDWASKQTYIALGNMMTAAAQIGVDSCPIEGFQYDHIHRIL EEEGLLENGSFDISVMVAFGYRVRDPRPKTRSAVEDVVKWV |
||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Discontinued/withdrawn Drugs | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
CBL-954 |
Drug Info | Discontinued | Hepatocellular carcinoma | ICD11: 2C12 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | uvrB gene deletion enhances SOS chromotest sensitivity for nitroreductases that preferentially generate the 4-hydroxylamine metabolite of the anti-cancer prodrug CB1954 | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

