| General Information of DME (ID: DMEN373) |
| DME Name |
pyruvate kinase M2 (PKM2), Homo sapiens
|
| Gene Name |
PKM2
|
| UniProt ID |
|
| EC Number |
EC: 2.7.1.40 (Click to Show/Hide the Complete EC Tree)
Transferase
Kinase
Phosphotransferase
EC: 2.7.1.40
|
| Lineage |
Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
|
|
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
|
| Sequence |
MSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTGIICTIGPASRSVET LKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAVALDTKGPEIR TGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIYVDDGL ISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIE IPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIM LSGETAKGDYPLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEAS FKCCSGAIIVLTKSGRSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQE AWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
|
| Structure |
1T5A
; 1ZJH
; 3BJF
; 3BJT
; 3G2G
; 3GQY
; 3GR4
; 3H6O
; 3ME3
; 3SRD
; 3SRF
; 3SRH
; 3U2Z
; 4B2D
; 4FXF
; 4FXJ
; 4G1N
; 4JPG
; 4QG6
; 4QG8
; 4QG9
; 4QGC
; 4RPP
; 4WJ8
; 4YJ5
; 5X0I
; 5X1V
; 5X1W
; 6B6U
; 6GG3
; 6GG4
; 6GG5
; 6GG6
; 6JFB
; 6NU1
; 6NU5
; 6NUB
; 6TTF
; 6TTH
; 6TTI
; 6TTQ
; 6V74
; 6V75
; 6V76
; 6WP3
; 6WP4
; 6WP5
; 6WP6
; 7L21
; 8HMQ
; 8HMR
; 8HMS
; 8HMU
|
| Function |
Catalyzes the final rate-limiting step of glycolysis by mediating the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) to ADP, generating ATP . The ratio between the highly active tetrameric form and nearly inactive dimeric form determines whether glucose carbons are channeled to biosynthetic processes or used for glycolytic ATP production . The transition between the 2 forms contributes to the control of glycolysis and is important for tumor cell proliferation and survival .; [Isoform M2]: Isoform specifically expressed during embryogenesis that has low pyruvate kinase activity by itself and requires allosteric activation by D-fructose 1,6-bisphosphate (FBP) for pyruvate kinase activity . In addition to its pyruvate kinase activity in the cytoplasm, also acts as a regulator of transcription in the nucleus by acting as a protein kinase . Translocates into the nucleus in response to various signals, such as EGF receptor activation, and homodimerizes, leading to its conversion into a protein threonine- and tyrosine-protein kinase . Catalyzes phosphorylation of STAT3 at 'Tyr-705' and histone H3 at 'Thr-11' (H3T11ph), leading to activate transcription . Its ability to activate transcription plays a role in cancer cells by promoting cell proliferation and promote tumorigenesis . Promotes the expression of the immune checkpoint protein CD274 in BMAL1-deficient macrophages (By similarity). May also act as a translation regulator for a subset of mRNAs, independently of its pyruvate kinase activity: associates with subpools of endoplasmic reticulum-associated ribosomes, binds directly to the mRNAs translated at the endoplasmic reticulum and promotes translation of these endoplasmic reticulum-destined mRNAs (By similarity). Plays a role in caspase independent cell death of tumor cells .; [Isoform M1]: Pyruvate kinase isoform expressed in adult tissues, which replaces isoform M2 after birth . In contrast to isoform M2, has high pyruvate kinase activity by itself and does not require allosteric activation by D-fructose 1,6-bisphosphate (FBP) for activity .
|
|
|
|
|
|
|