Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN388) | |||||
|---|---|---|---|---|---|
| DME Name | Retinol dehydrogenase 10 (RDH10), Homo sapiens | ||||
| Gene Name | RDH10 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.300 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Homo sapiens (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MNIVVEFFVVTFKVLWAFVLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRR
ALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG KRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAF LPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTL VCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMK SILPFEAVVCMYRFLGADKCMYPFIAQRKQATNNNEAKNGI |
||||
| Function | Retinol dehydrogenase with a clear preference for NADP. Converts all-trans-retinol to all-trans-retinal. Has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Beta carotene |
Drug Info | Approved | Vitamin deficiency | ICD11: 5B55 | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | #NAME? | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

