Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1028) | |||||
|---|---|---|---|---|---|
| DME Name | Chloramphenicolase (chlR), Escherichia coli | ||||
| Synonyms | Chloramphenicol reductase; Enzyme chloramphenicolase; Reductase chloramphenicol | ||||
| Gene Name | chlR | ||||
| UniProt ID | |||||
| EC Number | EC: 2.3.1.28 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Escherichia coli (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKKIDLNSWNRREHFAFFSQFDEPFFSIVAEVDCTVAYRKAKEQDIPFFIWYLYQSLLAA
NQVEPFRYRIIDNEVVVLDEIHASSTVAREDHTFGFTFMPYREDIKAFVAEALPEIERVQ QLEGLCFDEKTSRTDVIHYSSIPWINFTALTHARHNARKDSVPKISFGQYQEKEGKLMMP VSVTVHHGLMDGYHVGLFLTKFQKLLES |
||||
| Function | This enzyme catalyzes the hydrolysis of the amide bond in chloramphenicol. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Chloramphenicol |
Drug Info | Approved | Conjunctivitis | ICD11: 9A60 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | The bacterial degradation of chloramphenico. Lancet. 1967 Jun 10;1(7502):1259-60. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

