Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1080) | |||||
|---|---|---|---|---|---|
| DME Name | Azoreductase (azoR), Streptococcus salivarius | ||||
| Synonyms | Azo-dye reductase; FMN-dependent NADH-azo compound oxidoreductase; FMN-dependent NADH-azoreductase; Flavin reductase; NAD(P)H-dependent oxidoreductase; NADPH azoreductase; azoR; A6J87_06095; CKU37_01320; CQA85_07565; D8867_01950; DL07_01170; DWV94_10025; DWY30_01550; DWZ07_06240; FBF48_06605; NCTC8618_04344; azr_2; azr_4 | ||||
| Gene Name | azr_2 | ||||
| UniProt ID | |||||
| Gene ID | |||||
| EC Number | EC: 1.7.1.6 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Streptococcus salivarius (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MKFVGLVGANYDQSYNRKLLEFIRRHFKIKFELEVLEIDEVPMFNQDEKWDESFQLRLLN
NKITRADGVIIATPEHNHTISAALKSVLEWLSFEVHPFENKPVMIVGASYYDQGTSRAQV HLRKILEAPGVNAYTLPGNEFLLGKAKEAFDLEGNITNEGTINFLEQCLDNFIQYVGVVS KLKKPKPIEPEDLDCNNPIATTVTEVDPDDPEWVEKVAEITGAVSGDTYVKLDHGILTVN QIDMFLKAMPFELTYADDNNQFLYYNNAHQDPDTMFAKRVPPQSGSRMSTVHGSLPPARM KNVEWVIGTLRNGNQEYVRTIVPGSPEGVINTHNYQAMYYDDGSYAGINEIVFNFKPWLD WYLETTGQRLVGGSGPFAPAAASHGGSDATSGASDAGGHGGDAAPAADATSGASSY |
||||
| Function | This enzyme can reduce other azo dyes, such as Methyl Red, Rocceline, Solar Orange and Sumifix Black B. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Sulfasalazine |
Drug Info | Approved | Rheumatoid arthritis | ICD11: FA20 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | The influence of probiotic treatment on sulfasalazine metabolism in rat. Xenobiotica. 2012 Aug;42(8):791-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

