Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1115)
DME Name	S-adenosylhomocysteine nucleosidase (mtnN), Klebsiella pneumoniae
Synonyms	AdoHcy nucleosidase; DOA nucleosidase; MTA nucleosidase; MTA/SAH nucleosidase; MTAN; SAH nucleosidase; SRH nucleosidase; dAdo nucleosidase; 5'-deoxyadenosine nucleosidase; 5'-methylthioadenosine nucleosidase; 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase; mtnN
Gene Name	mtnN
UniProt ID	MTNN_KLEPN
EC Number	EC: 3.2.2.9 (Click to Show/Hide the Complete EC Tree) Hydrolases Glycosylase N-Glycosyl compound glycosidase EC: 3.2.2.9
Lineage	Species: Klebsiella pneumoniae (Click to Show/Hide the Complete Species Lineage) Kingdom: Bacteria Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Klebsiella Species: Klebsiella pneumoniae
Interactome (loading-time for this interactome depdends on the speed of web connection)
Interactions between Xenobiotics and DME (XEOTIC) Jump to Detailed Interactome Data
Interactions between Host Protein and DME (HOSPPI) Jump to Detailed Interactome Data

Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution	Primarily distributed in human gut.
Sequence	MKIGIIGAMEEEVTLLRDKIENRQTITIGGSEIYT
Function	This enzyme acts on S-methyl-5'-thioadenosine to give adenine and S-methyl-5-thioribose.

Full List of Drug(s) Metabolized by This DME
Preclinical/investigative Agents			Click to Show/Hide the Full List of Drugs: 1 Drugs
Methylthioadenosine	Drug Info	Investigative	Multiple sclerosis	ICD11: 8A40	[1]

References
1	Selective killing of Klebsiella pneumoniae by 5-trifluoromethylthioribose. Chemotherapeutic exploitation of the enzyme 5-methylthioribose kinase. J Biol Chem. 1990 Jan 15;265(2):831-7.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.