Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1116) | |||||
|---|---|---|---|---|---|
| DME Name | D-Lactate dehydrogenase (ldhA), Megasphaera elsdenii | ||||
| Synonyms | Glycolate dehydrogenase; D-lactate ferricytochrome C oxidoreductase; Fermentative lactate dehydrogenase; D-LDH; Q058_03541; ldhA | ||||
| Gene Name | ldhA | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.28 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Megasphaera elsdenii (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MRILFFSSQAYDSESFQASNHRHGFELHFQQAHLQADTAVLAQGFEVVCAFVNDDLSRPV
LERLAAGGTRLVALRSAGYNHVDLAAAEALGLPVVHVPAYSPHAVAEHAVGLILTLNRRL HRAYNRTREGDFSLHGLTGFDLHGKRVGVIGTGQIGETFARIMTGFGCELLAYDPYPNPR IQALGGRYLALDALLAESDIVSLHCPLTADTRHLIDAQRLATMKPGAMLINTGRGALVNA AALIEALKSGQLGYLGLDVYEEEADIFFEDRSDQPLQDDVLARLLSFPNVVVTAHQAFLT REALAAIADTTLDNIAAWQDGTPRNRVRA |
||||
| Function | This enzyme has D-lactate dehydrogenase activity. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 2 Drugs | ||||
Methylglyoxal |
Drug Info | Investigative | Alzheimer disease | ICD11: 8A20 | [1] |
D-glucose |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [2], [3] |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

