Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1238) | |||||
|---|---|---|---|---|---|
| DME Name | Ribosomal 23S RNA methyltransferase Erm (erm), Corynebacterium jeikeium | ||||
| Synonyms | Ribosomal RNA methyltransferase Erm; 23S rRNA methyltransferase Erm; 23S ribosomal RNA methyltransferase Erm; NCTC11913_00479; erm(X) | ||||
| Gene Name | erm(X) | ||||
| UniProt ID | |||||
| EC Number | EC: 2.1.1.182 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Corynebacterium jeikeium (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human skin. | ||||
| Sequence |
MSTYGYGRHEHGQNFLTDHKIINSIVDLVKESSGPIIEIGPGSGALTHPLSRLGRPITAV
EVDAKLAAKLTKKTASASVEVVHGDFLNFPLPATPCVIVGNIPFHLTTAILRELLHAPAW TDAVLLMQWEVARRRAGVGASTMMTAQWSPWFTFHLGSRVPRSAFRPQPNVDGGILVIRR VGDPKIPIEQRKAFQAMVHTVFTARGRGIGEILRRAGLFSSRSETQSWLRSRGIDPATLP PRLRTSDWIDLFQVTGFSPPRHRPISQSGSSQRPPQRKKRGRRR |
||||
| Function | This enzyme introduces the most highly conserved ribosomal RNA modification, the dimethylation of adenine1518 and adenine1519 in 16S rRNA. And Strains lacking the methylase are resistant to kasugamycin. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Tacrolimus |
Drug Info | Approved | Ulcerative colitis | ICD11: DD71 | [1] |
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Pentamycin |
Drug Info | Investigative | Candidiasis | ICD11: 1F23 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | High frequency of macrolide resistance mechanisms in clinical isolates of Corynebacterium species. Microb Drug Resist. 2010 Dec;16(4):273-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

