Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1246) | |||||
|---|---|---|---|---|---|
| DME Name | Nitroreductase (NTR), Clostridium hiranonis | ||||
| Synonyms | FMN reductase (NAD(P)H); FMN reductase NADPH; nfrA2; DCW51_03155 | ||||
| Gene Name | DCW51_03155 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.5.1.39 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Clostridium hiranonis (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human gut. | ||||
| Sequence |
MNKEYLNDTIKLLCERASCRSFLDKKIPDELLNEIISCGLHAATGGNLQPYSIIKITDDK
TKERLVNECDMQSLVKNAPVNLLFCIDWRRIQRWCEASDAPFVATKSYRHFWIALQDTII CAQNICTAADSIGLGSVYIGTVESCFMELKSIFNIPEGVFPVVLLSIGYPNQPLIPAPKL GIEAIVHEESYKDLTIDTLVKLQNEKYNSKKFPLSPTNTASMKEVTLDIGGEDYSNKIIT SIEQQGYINMAQRYFGLHYKANWSCIGNKNFIEALKAYGFTWIMGEDFPTGDK |
||||
| Function | This enzyme uses NADH as source of reducing equivalents to reduce of a variety of nitroaromatic compounds. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Nitrofurantoin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
P-nitrobenzoic acid |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Isolation of nitrofurantoin-resistant mutants of nitroreductase-producing Clostridium sp. strains from the human intestinal tract. Antimicrob Agents Chemother. 1998 May;42(5):1121-6. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

