Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DME1302)
DME Name General stress protein 14 (ywrO), Bacillus subtilis
Synonyms Alkyl hydroperoxide reductase; Reductase alkyl hydroperoxide; GS protein 14; GSP14; BSU35990; ywrO
Gene Name ywrO
UniProt ID
GS14_BACSU
Gene ID
936853
EC Number    EC: 1.6.99.-     (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
NADH/NADPH oxidoreductase
Other acceptor oxidoreductase
EC: 1.6.99.-
Lineage    Species: Bacillus subtilis     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Firmicutes
Class: Bacilli
Order: Bacillales
Family: Bacillaceae
Genus: Bacillus
Species: Bacillus subtilis
Interactome
(loading-time for this interactome depdends on the speed of web connection)
       Interactions between Xenobiotics and DME (XEOTIC)                      
Jump to Detailed Interactome Data                      
       Interactions between Host Protein and DME (HOSPPI)                     
Jump to Detailed Interactome Data                      
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Tissue Distribution Primarily distributed in human gut.
Sequence
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRI
VFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGAN
HYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV
Function This enzyme has electron transfer activity, FMN binding, and NAD(P)H dehydrogenase (quinone) activity.
Full List of Drug(s) Metabolized by This DME
      Discontinued/withdrawn Drugs Click to Show/Hide the Full List of Drugs:          1 Drugs
CBL-954
 Drug Info Discontinued Hepatocellular carcinoma ICD11: 2C12 [1]
References
1 Bacillus amyloliquefaciens orthologue of Bacillus subtilis ywrO encodes a nitroreductase enzyme which activates the prodrug CB 1954. Microbiology. 2002 Jan;148(Pt 1):297-306.

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.