Details of Drug-Metabolizing Enzyme (DME)
General Information of DME (ID: DME1643) | |||||
---|---|---|---|---|---|
DME Name | Beta-lactamase (blaB), Chromobacterium violaceum | ||||
Synonyms | Penicillinase; Cephalosporinase; Beta-lactam; NCTC9695_01822 | ||||
Gene Name | ampC | ||||
UniProt ID | |||||
EC Number |
EC: 3.5.2.6 (Click to Show/Hide the Complete EC Tree) |
||||
Lineage |
Species: Chromobacterium violaceum (Click to Show/Hide the Complete Species Lineage) |
||||
Interactome (loading-time for this interactome depdends on the speed of web connection) |
|||||
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
Tissue Distribution | Primarily distributed in human skin. | ||||
Sequence |
MMQSLKFRTLAGMLGCLTFLPLAAQAANDAGKSDLDAAVEATIPPLMKAKDIPGMAVAVL
ADGKAHYFNYGVASRETGQPVTQDTLFELGSISKTFTGILGGYALAQGKLSLADKASRYQ PELKGSVFDRVSLLQLATYSAGGLPLQFPDAVAGQASMLAYYRGWKPDYAPGERRLYSNP SIGLFGHLAARSLGQPFDQAMERGLLPKLGLSHTFIHVPEAEQSRYAWGYAKAGKPIRVG AGVLDAEAYGIKSSAADLLKYLAINMSPPADPALQRALDASHAAYYRVGDMRQGLGWEGY RYPISLERLLAGNSNEIAFQPQKVEWLNPPRLAEGDVLLNKTGSTSGFGAYVLFVPARKV GIVMLANRNYPNAERVRAAYRILLAVDPSLARRRGD |
||||
Function | This enzyme hydrolyzes beta-lactam. | ||||
Full List of Drug(s) Metabolized by This DME | |||||
---|---|---|---|---|---|
Drugs Approved by FDA | Click to Show/Hide the Full List of Drugs: 3 Drugs | ||||
Cefoxitin |
Drug Info | Approved | Peritonitis | ICD11: DC50 | [1] |
Carbenicillin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
Ticarcillin |
Drug Info | Approved | Infectious cystitis | ICD11: GC00 | [1] |
References | |||||
---|---|---|---|---|---|
1 | Beta-lactamase activity in Chromobacterium violaceum. J Infect Dis. 1976 Sep;134(3):290-3. |
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.