Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DME1906) | |||||
|---|---|---|---|---|---|
| DME Name | Alcohol dehydrogenase (ADH), Neisseria sicca | ||||
| Synonyms | Alcohol dehydrogenase AdhP; Zinc-dependent alcohol dehydrogenase; Zn-dependent alcohol dehydrogenase; CYK00_08895 | ||||
| Gene Name | ADH | ||||
| UniProt ID | |||||
| EC Number | EC: 1.1.1.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Neisseria sicca (Click to Show/Hide the Complete Species Lineage) | ||||
| Interactome(loading-time for this interactome depdends on the speed of web connection) | |||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Tissue Distribution | Primarily distributed in human oral cavity. | ||||
| Sequence |
MKAMVYHGANDIRFEEKPRPQIIDPTDAVVKIVKTTICGTDLGIWKGKNPEVADGRILGH
EGIGIVEEVGEAVKNIKVGDKVIISCVSKCCTCDNCKIQLYSHCRNGGWILGYIIDGTQA EYVRTPYADNSLVPLPDNVNEEVALLLSDALPTAHEIGVQYGDVKPGDTVFIAGAGPVGM SALLTAQLYSPAAIIVCDMDENRLKLAKELGATHTISPASGDVSKQVFAIVGEDGVDCAI EAVGIPATWNMCQDIVKPGGHIAVVGVHGQSVDFKLEKLWIKNLAITTGLVNANTTEMLM KAISSSSVDYTKMLTHHFKFSELEKAYDVFKHAAENQAMKVVLEAD |
||||
| Function | This enzyme acts on primary or secondary alcohols or hemi-acetals with very broad specificity and the enzyme oxidizes methanol much more poorly than ethanol. | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Ethanol |
Drug Info | Phase 2 | Diabetic nephropathy | ICD11: GB61 | [1] |
| References | |||||
|---|---|---|---|---|---|
| 1 | Functional profiles of coronal and dentin caries in children. J Oral Microbiol. 2018 Jul 16;10(1):1495976. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

