| General Information of DME (ID: DME1971) |
| DME Name |
Oxygen-insensitive NADPH nitroreductase A (nfsA), Salmonella enterica
|
| Synonyms |
Oxygen-insensitive NAD(P)H nitroreductase A; Modulator of drug activity A; STM0874; mdaA; nfsA; pnrA; snrA
|
| Gene Name |
nfsA
|
| UniProt ID |
|
| Gene ID |
|
| EC Number |
EC: 1.5.1.38 (Click to Show/Hide the Complete EC Tree)
Oxidoreductase
CH-NH donor oxidoreductase
NAD/NADP acceptor oxidoreductase
EC: 1.5.1.38
|
| Lineage |
Species: Salmonella enterica (Click to Show/Hide the Complete Species Lineage)
Kingdom: Bacteria
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Salmonella
Species: Salmonella enterica
Subspecies: Salmonella enterica subsp. enterica serovar Typhimurium
Subspecies: Salmonella enterica subsp. enterica serovar Typhimurium TA100
|
|
Interactome(loading-time for this interactome depdends on the speed of web connection)
|
Interactions between Xenobiotics and DME (XEOTIC)
Jump to Detailed Interactome Data
|
Interactions between Host Protein and DME (HOSPPI)
Jump to Detailed Interactome Data
|
|
|
|
Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
|
| Tissue Distribution |
Primarily distributed in human gut.
|
| Sequence |
MSPTIELLCGHRSIRHFTDEPVTDAQREAIIAAARSTSSSSFLQCSSIIRITDRALREAL VPLTGGQKHVAQAAEFWVFCADFNRHLQICPDAQLGLAEQLLLGVVDTAMMGQNALTAAE SLGLGGVYIGGIRNNIESVTELLKLPKHVLPLFGLCLGWPADNPDLKPRLPAELVVHENQ YQPLDEKLLARYDEQLAEYYLTRGSNTRRDTWSDHIRRTLIKENRPFILEYLHKQGWATR
|
| Pathway |
Microbial metabolism in diverse environments (stm01120 ) |
| Nitrotoluene degradation (stm00633 ) |
| Function |
This enzyme catalyzes the reduction of nitroaromatic compounds using NADPH, and has a broad electron acceptor specificity. Moreover, it reduces nitrofurazone by a ping-pong bi-bi mechanism possibly to generate a two-electron transfer product.
|
|
|
|
|
|
|