Details of Drug-Metabolizing Enzyme (DME)

General Information of DME (ID: DMEN017)
DME Name Aflatoxin B1 aldehyde reductase member 3 (AKR7A3), Homo sapiens
Gene Name AKR7A3
UniProt ID
ARK73_HUMAN
Lineage    Species: Homo sapiens     (Click to Show/Hide the Complete Species Lineage)
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
      Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME
Sequence
MSRQLSRARPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGG
LGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTP
VEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVE
TELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTWAEMYRNRYWKEH
HFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLA
AAEEGPLEPAVVDAFNQAWHLVTHECPNYFR
Structure
2CLP ;
Function Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen.
Full List of Drug(s) Metabolized by This DME
      Drugs Approved by FDA Click to Show/Hide the Full List of Drugs:          1 Drugs
Bupropion
 Drug Info Approved Nicotine dependence ICD11: 6C4A [1]
Full List of Metabolic Reactions (MR) Catalyzed by This DME
MR ID Reactant Product MR Type Source Drug REF
MR000516 Bupropion R,R-threohydrobupropion Reduction - Ketoreduction Bupropion [1]
MR000517 Bupropion S,S-threohydrobupropion Reduction - Ketoreduction Bupropion [1]
MR000518 Bupropion R,S-erythrohydrobupropion Reduction - Ketoreduction Bupropion [1]
MR000519 Bupropion S,R-erythrohydrobupropion Reduction - Ketoreduction Bupropion [1]
MR000501 R-4'-hydroxybupropion R,S-erythro-4'-hydroxy-hydrobupropion Reduction - Ketoreduction Bupropion [1]
MR000504 R-4'-hydroxybupropion R,R-threo-4'-hydroxy-hydrobupropion Reduction - Ketoreduction Bupropion [1]
MR000499 S-4'-hydroxybupropion R,S-erythro-4'-hydroxy-hydrobupropion Reduction - Ketoreduction Bupropion [1]
MR000500 S-4'-hydroxybupropion S,S-threo-4'-hydroxy-hydrobupropion Reduction - Ketoreduction Bupropion [1]
⏷ Show the Full List of 8 MR(s)
References
1 DrugBank(Pharmacology-Metabolism)Bupropion

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.