Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN036) | |||||
|---|---|---|---|---|---|
| DME Name | Permidine/putrescine ABC transporter substrate-binding protein (BleG1_1835), Bacillus pumilus | ||||
| Gene Name | BleG1_1835 | ||||
| UniProt ID | |||||
| EC Number | EC: 3.1.1.1 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Bacillus pumilus (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MKKSITVTLGMAAITALVGCGQSGSDPSEAPTDLVISTWGFAEDFFNEEVYAPFEEEHNV
NIVVDIGNNAERLNRIRQGTATIDVIYLSDYYAQQGIDEGLFANIDRSRIPAIEDLYDLA QAPLGEEYGPAYTVGQFGIAYNPDEVESPITSWSDLWDEALANNITLPNITATTGPMFLD AASIVAGEETFNEDAAFDQLNTLKGNVVKEYDRTSDFVNMFSQGEIVAGPFMEMYLKDLL AAVPGTEFVTPSEGAYAVLNTVNVVEGSNNKELAEEFINWHLSKEVQEASAKAKIDSPVN KLVELSSEEAEGITYGEDTINELKLLDMEFVNEQSAQWIDRWNREIAN |
||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Preclinical/investigative Agents | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
Agmatine |
Drug Info | Investigative | Discovery agent | ICD: N.A. | [1] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Metabolism and function in animal tissues of agmatine, a biogenic amine formed from arginine Amino Acids. 2004 Feb;26(1):3-8. doi: 10.1007/s00726-003-0030-z. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

