Details of Drug-Metabolizing Enzyme (DME)
| General Information of DME (ID: DMEN356) | |||||
|---|---|---|---|---|---|
| DME Name | Steroid C26-monooxygenase (cyp142A1), Mycobacterium tuberculosis | ||||
| Gene Name | cyp142A1 | ||||
| UniProt ID | |||||
| EC Number | EC: 1.14.15.28 (Click to Show/Hide the Complete EC Tree) | ||||
| Lineage | Species: Mycobacterium tuberculosis (Click to Show/Hide the Complete Species Lineage) | ||||
| Click to Show/Hide the Molecular/Functional Data (Sequence/Structure/Pathway/Function) of This DME | |||||
| Sequence |
MTEAPDVDLADGNFYASREARAAYRWMRANQPVFRDRNGLAAASTYQAVIDAERQPELFS
NAGGIRPDQPALPMMIDMDDPAHLLRRKLVNAGFTRKRVKDKEASIAALCDTLIDAVCER GECDFVRDLAAPLPMAVIGDMLGVRPEQRDMFLRWSDDLVTFLSSHVSQEDFQITMDAFA AYNDFTRATIAARRADPTDDLVSVLVSSEVDGERLSDDELVMETLLILIGGDETTRHTLS GGTEQLLRNRDQWDLLQRDPSLLPGAIEEMLRWTAPVKNMCRVLTADTEFHGTALCAGEK MMLLFESANFDEAVFCEPEKFDVQRNPNSHLAFGFGTHFCLGNQLARLELSLMTERVLRR LPDLRLVADDSVLPLRPANFVSGLESMPVVFTPSPPLG |
||||
| Structure | |||||
| Function | Involved in the utilization of cholesterol as the sole carbon and energy source by degrading the side chain during infection . Primarily catalyzes the sequential oxidation of the terminal methyl of cholest-4-en-3-one into (25R)-26-hydroxycholest-4-en-3-one (alcohol), (25R)-26-oxocholest-4-en-3-one (aldehyde), to finally yield the carboxylic acid (25R)-3-oxocholest-4-en-26-oate . In vitro, Cyp142 catalyzes with equal preference the oxidation of both (25R)- and (25S)-26-hydroxycholest-4-en-3-one diastereomers to the corresponding carboxylic acid which is a prerequisite for entry into the beta-oxidation pathway . Also able to sequentially oxidize cholesterol itself, not only cholest-4-en-3-one . | ||||
| Full List of Drug(s) Metabolized by This DME | |||||
|---|---|---|---|---|---|
| Drugs in Phase 2 Clinical Trial | Click to Show/Hide the Full List of Drugs: 1 Drugs | ||||
ANW-32821 |
Drug Info | Phase 2 | Cone rod dystrophy | ICD11: 9B70 | [1], [2] |
| Full List of Metabolic Reactions (MR) Catalyzed by This DME | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
||||||||||||||||||||||||||||||||||
If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.

