Target General Infomation
Target ID
T89534
Former ID
TTDS00242
Target Name
Estrogen receptor
Gene Name
ESR1
Synonyms
ER; ER-alpha; ERalpha; Estradiol receptor; Estrogen receptor alpha; Oestrogen receptor; Oestrogen receptor alpha; ESR1
Target Type
Successful
Disease Adrenocortical carcinoma [ICD9: 194; ICD10: C74.0]
Advanced prostate cancer [ICD9: 185; ICD10: C61]
Atrophic vaginitis [ICD9: 627.3; ICD10: N95.2]
Atrophy [ICD10: M62.571]
Arthralgia [ICD10: M25.5]
Acne vulgaris [ICD9: 706.1; ICD10: L70.0]
Autoimmune diabetes [ICD10: E08-E13]
Breast cancer; Prostate cancer; Female infertility [ICD9:174, 175, 185, 628; ICD10: C50, C61, N97.0]
Brain cancer [ICD9: 191, 225.0; ICD10: C71, D33]
Breast cancer [ICD9: 174, 175; ICD10: C50]
Contraception [ICD10: Z30]
Carcinoma [ICD9: 230-234; ICD10: D00-D09]
Cancer [ICD9: 140-229; ICD10: C00-C96]
Dysmenorrhea [ICD9: 625.3; ICD10: N94.4-N94.6]
Dyspareunia [ICD10: N94.1]
Eye disorders [ICD10: H00-H59]
Estrogen deficiency [ICD10: E28.39]
Female infertility due to anovulation [ICD10: N97.0]
Female infertility [ICD9: 628; ICD10: N97.0]
Female hypogonadism [ICD9: 253, 256; ICD10: E23, E28]
Female sexual dysfunction [ICD9: 302.7; ICD10: F52]
Gonorrheal vaginitis; Cancer [ICD9:98, 140-229; ICD10: A54, C00-C96]
Hypogonadism [ICD9: 257.2; ICD10: E23.0, E28.3, E29.1]
Hormone deficiency [ICD10: E00-E90]
Hormone replacement therapy [ICD9: V07.4; ICD10: Z79.890]
Hyperlipidaemia [ICD9: 272.0-272.4; ICD10: E78]
Infertility [ICD9: 628; ICD10: N97.0]
Irregularities [ICD10: N92.6]
Leukemia [ICD9: 208.9; ICD10: C90-C95]
Menopause symptoms [ICD10: N95.0]
Menopause symptoms; Hormone refractory prostate cancer [ICD9:140-229, 185; ICD10: N95.0, C61]
Menorrhagia [ICD9: 627; ICD10: N92.0]
Multiple scierosis; Hormone deficiency [ICD9:340; ICD10: G35, E00-E90]
Menopausal disorder; Postmenopausal disorder [ICD9: 627; ICD10: N95]
Multiple scierosis [ICD9: 340; ICD10: G35]
Neurological disease [ICD9: 338, 338.2, 410, 782.3,780; ICD10: I21, I22, R52, R52.1-R52.2, R60.9, G89]
Osteoporosis [ICD9: 733.0, V07.4; ICD10: M80-M81, Z79.890]
Oral contraceptives [ICD10: Z30]
Osteopetrosis [ICD10: Q78.2]
Post-menopausal vaginal atrophy [ICD9: 627.3; ICD10: N95.2]
Pain [ICD9: 338, 356.0, 356.8,780; ICD10: G64, G90.0, R52, G89]
Trematode infection [ICD10: B66.9]
Vagina disease [ICD10: N76.0]
Unspecified [ICD code not available]
Function
Nuclear hormone receptor. The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. Ligand-dependent nuclear transactivation involves either direct homodimer binding to a palindromic estrogen response element (ERE) sequence or association with other DNA- binding transcription factors, such as AP-1/c-Jun, c-Fos, ATF-2, Sp1 and Sp3, to mediate ERE-independent signaling. Ligand binding induces a conformational change allowing subsequent or combinatorial associationwith multiprotein coactivator complexes through LXXLL motifs of their respective components. Mutual transrepression occurs between the estrogen receptor (ER) and NF- kappa-B in a cell-type specific manner. Decreases NF-kappa-B DNA- binding activity and inhibits NF-kappa-B-mediated transcription from the IL6 promoter and displace RELA/p65 and associated coregulators from the promoter. Recruited tothe NF-kappa-B response element of the CCL2 and IL8 promoters and can displace CREBBP. Present with NF-kappa-B components RELA/p65 and NFKB1/p50 on ERE sequences. Can also act synergistically with NF-kappa-B to activate transcription involving respective recruitment adjacent response elements; the function involves CREBBP. Can activate the transcriptional activity of TFF1. Also mediates membrane-initiated estrogen signaling involving various kinase cascades. Isoform 3 is involved in activation of NOS3 and endothelial nitric oxide production. Isoforms lacking one or several functional domains are thought to modulate transcriptional activity by competitive ligand or DNA binding and/or heterodimerization with the full length receptor. Essential for MTA1-mediated transcriptional regulation ofBRCA1 and BCAS3. Isoform 3 can bind to ERE and inhibit isoform 1.
BioChemical Class
Zinc-finger
Target Validation
T89534
UniProt ID
Sequence
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
Structure
1A52; 1AKF; 1ERE; 1ERR; 1G50; 1GWQ; 1GWR; 1HCP; 1HCQ; 1L2I; 1PCG; 1QKT; 1QKU; 1R5K; 1SJ0; 1UOM; 1X7E; 1X7R; 1XP1; 1XP6; 1XP9; 1XPC; 1XQC; 1YIM; 1YIN; 1ZKY; 2AYR; 2B1V; 2B1Z; 2B23; 2BJ4; 2FAI; 2G44; 2G5O; 2I0J; 2IOG; 2IOK; 2JF9; 2JFA; 2LLO; 2LLQ;2OCF; 2OUZ; 2P15; 2POG; 2Q6J; 2Q70; 2QA6; 2QA8; 2QAB; 2QE4; 2QGT; 2QGW; 2QH6; 2QR9; 2QSE; 2QXM; 2QXS; 2QZO; 2R6W; 2R6Y; 2YAT; 2YJA; 3CBM; 3CBO; 3CBP; 3DT3; 3ERD; 3ERT; 3HLV; 3HM1; 3L03; 3OS8; 3OS9; 3OSA; 3Q95; 3Q97; 3UU7; 3UUA; 3UUC; 3UUD; 4AA6; 4DMA; 4IU7; 4IUI; 4IV2; 4IV4; 4IVW; 4IVY; 4IW6; 4IW8; 4IWC; 4IWF; 4JC3; 4JDD; 4MG5; 4MG6; 4MG7; 4MG8; 4MG9; 4MGA; 4MGB; 4MGC; 4MGD; 4O6F; 4PP6; 4PPP; 4PPS; 1A52; 1AKF; 1ERE; 1ERR; 1G50; 1GWQ; 1GWR; 1HCP; 1HCQ; 1L2I; 1PCG; 1QKT; 1QKU; 1R5K; 1SJ0; 1UOM; 1X7E; 1X7R; 1XP1; 1XP6; 1XP9; 1XPC; 1XQC; 1YIM; 1YIN; 1ZKY; 2AYR; 2B1V; 2B1Z; 2B23; 2BJ4; 2FAI; 2G44; 2G5O; 2I0J; 2IOG; 2IOK; 2JF9; 2JFA; 2LLO; 2LLQ; 2OCF; 2OUZ; 2P15; 2POG; 2Q6J; 2Q70; 2QA6; 2QA8; 2QAB; 2QE4; 2QGT; 2QGW; 2QH6; 2QR9; 2QSE; 2QXM; 2QXS; 2QZO; 2R6W; 2R6Y; 2YAT; 2YJA; 3CBM;3CBO; 3CBP; 3DT3; 3ERD; 3ERT; 3HLV; 3HM1; 3L03; 3OS8; 3OS9; 3OSA; 3Q95; 3Q97; 3UU7; 3UUA; 3UUC; 3UUD; 4AA6; 4DMA; 4IU7; 4IUI; 4IV2; 4IV4; 4IVW; 4IVY; 4IW6; 4IW8; 4IWC; 4IWF; 4JC3; 4JDD; 4MG5; 4MG6; 4MG7; 4MG8; 4MG9; 4MGA; 4MGB; 4MGC; 4MGD; 4O6F; 4PP6; 4PPP; 4PPS
Drugs and Mode of Action
Drug(s) ARZOXIFENE Drug Info Approved Breast cancer [521695], [549961]
Bazedoxifene Drug Info Approved Osteopetrosis [524681], [542376], [551871]
Cenestin Drug Info Approved Menopause symptoms [551871]
Chlorotrianisene Drug Info Approved Menopause symptoms; Hormone refractory prostate cancer [542153], [550720], [551871]
Clomifene Drug Info Approved Female infertility [536296], [542607]
Clomiphene Citrate Drug Info Approved Female infertility due to anovulation [551871]
Conjugated estrogens a Drug Info Approved Hormone replacement therapy [551871]
Conjugated estrogens b Drug Info Approved Hormone replacement therapy [551871]
Cyclofenil Drug Info Approved Infertility [551871]
Danazol Drug Info Approved Menorrhagia [536737], [541983]
Dienestrol Drug Info Approved Atrophic vaginitis [538391], [542169], [551871]
Diethylstilbestrol Drug Info Approved Gonorrheal vaginitis; Cancer [539842], [550715], [551871]
Esterified estrogens Drug Info Approved Breast cancer [551871]
Estradiol Drug Info Approved Breast cancer [533433], [534694], [536361], [538620], [551871]
Estradiol Acetate Drug Info Approved Hormone replacement therapy [551871]
Estradiol Cypionate Drug Info Approved Hormone replacement therapy [551871]
Estradiol Valerate Drug Info Approved Hormone replacement therapy [551871]
Estratab Drug Info Approved Osteoporosis [551871]
Estriol Drug Info Approved Multiple scierosis; Hormone deficiency [539864], [550696], [551871]
Estrogen Drug Info Approved Menopause symptoms [551871]
Estrone Drug Info Approved Menopausal disorder; Postmenopausal disorder [538356], [539860]
Estropipate Drug Info Approved Hypogonadism [551871]
Ethinyl Estradiol Drug Info Approved Female hypogonadism [536361], [542077]
Fosfestrol Drug Info Approved Cancer [551871]
Fulvestrant Drug Info Approved Breast cancer [536361], [538622]
Gestrinone Drug Info Approved Breast cancer [551871]
Lasofoxifene Drug Info Approved Osteoporosis [542544], [549974]
Levormeloxifene non-steroidal Drug Info Approved Breast cancer [546694]
Mestranol Drug Info Approved Oral contraceptives [538441], [542092]
Mitotane Drug Info Approved Adrenocortical carcinoma [538481], [541993]
Nomegestrol acetate Drug Info Approved Breast cancer [526905], [533386], [551871]
Ospemifene Drug Info Approved Dyspareunia [532651], [542369]
Premarin/Trimegestone Drug Info Approved Menopause symptoms [551871]
Promestriene Drug Info Approved Acne vulgaris [551871]
Quinestrol Drug Info Approved Breast cancer; Prostate cancer; Female infertility [542103], [550697], [551871]
Raloxifene Drug Info Approved Osteoporosis [551871]
Tamoxifen Drug Info Approved Breast cancer [536863], [538623]
Toremifene Drug Info Approved Breast cancer [467663], [536361]
Raloxifene Drug Info Phase 4 Osteoporosis [523817], [539863]
Acolbifene Drug Info Phase 3 Breast cancer [523658]
NPC-01 Drug Info Phase 3 Dysmenorrhea [523263]
Ospemifene Drug Info Phase 3 Post-menopausal vaginal atrophy [542369], [551684]
Premarin/Pravachol Drug Info Phase 3 Hyperlipidaemia [535747]
Synthetic conjugated estrogen Drug Info Phase 3 Vagina disease [521865]
Trimegestone/ethinyl estradiol Drug Info Phase 3 Contraception [547436]
Afimoxifene Drug Info Phase 2 Breast cancer [521779]
Androgen restored contraceptive Drug Info Phase 2 Contraception [527054]
ARN-810 Drug Info Phase 2 Breast cancer [524250]
Danazol Drug Info Phase 2 Breast cancer [541983], [551871]
Endoxifen Drug Info Phase 2 Breast cancer [525020]
Estetrol Drug Info Phase 2 Autoimmune diabetes [522168]
Estrogen receptor beta-selective phytoestrogenic formulation Drug Info Phase 2 Menopause symptoms [531544]
GTx-758 Drug Info Phase 2 Advanced prostate cancer [523416]
ICARITIN Drug Info Phase 2 Breast cancer [524499]
RAD-1901 Drug Info Phase 2 Breast cancer [522627]
SR 16234 Drug Info Phase 2 Breast cancer [531682]
ATD transdermal gel Drug Info Phase 1 Contraception [548351]
CC-8490 Drug Info Phase 1 Brain cancer [521581]
CHF-4227 Drug Info Phase 1 Osteoporosis [547486]
BN-AA-003-NY Drug Info Preclinical Estrogen deficiency [548258]
BN-AO-014 Drug Info Preclinical Atrophy [548258]
BN-CB-045 Drug Info Preclinical Female sexual dysfunction [548258]
BN-DF-037 Drug Info Preclinical Osteoporosis [548258]
BN-GU-005-DHP Drug Info Preclinical Arthralgia [548258]
BN-OD-026 Drug Info Preclinical Cancer [548258]
BITHIONOL Drug Info Withdrawn from market Trematode infection [539482], [551871]
HEXESTROL Drug Info Withdrawn from market Irregularities [533402], [534328], [539866]
EM-800 Drug Info Discontinued in Phase 3 Estrogen deficiency [546717]
Idoxifene Drug Info Discontinued in Phase 3 Breast cancer [545487]
IoGen Drug Info Discontinued in Phase 3 Pain [546955]
Miproxifene Drug Info Discontinued in Phase 3 Cancer [544738]
Droloxifene Drug Info Discontinued in Phase 2 Breast cancer [544750]
ERA-923 Drug Info Discontinued in Phase 2 Breast cancer [546969]
NP-50301 Drug Info Discontinued in Phase 2 Eye disorders [548161]
Panomifene Drug Info Discontinued in Phase 2 Cancer [545192]
SERM-3339 Drug Info Discontinued in Phase 2 Osteoporosis [547193]
SR-90067 Drug Info Discontinued in Phase 2 Hormone deficiency [546799]
HRT Drug Info Discontinued in Phase 1 Estrogen deficiency [546947]
MX-4509 Drug Info Discontinued in Phase 1 Neurological disease [547955]
ICI-164384 Drug Info Terminated Breast cancer [544737]
LY-117018 Drug Info Terminated Discovery agent [544760]
Tamoxifen methyl iodide Drug Info Terminated Discovery agent [546052]
Zindoxifene Drug Info Terminated Breast cancer [544757]
ZK-119010 Drug Info Terminated Carcinoma [529380]
Inhibitor 1,2-Bis-(4-hydroxy-phenyl)-3H-inden-5-ol Drug Info [527738]
1,8-Dichloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
1-Bromo-6-(4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
1-Chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
1-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
17-METHYL-17-ALPHA-DIHYDROEQUILENIN Drug Info [551374]
2,3-diphenyl-1H-indole Drug Info [527797]
2,4-Dibenzylamino-6-isopentylpyrimidine Drug Info [529687]
2,4-diisobutylamino-6-isopentylpyrimidine Drug Info [529687]
2-(2-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
2-(3-Butoxy-4-hydroxy-phenyl)-benzooxazol-6-ol Drug Info [527232]
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
2-(3-Chloro-4-hydroxy-phenyl)-benzooxazol-6-ol Drug Info [527232]
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
2-(3-Fluoro-4-hydroxy-phenyl)-benzooxazol-6-ol Drug Info [527232]
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol Drug Info [526532]
2-(3-hydroxyphenyl)-1,2'-spirobi[1H-indene]-6-ol Drug Info [526532]
2-(4-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-4-methoxy-quinolin-6-ol Drug Info [527681]
2-(4-Hydroxy-phenyl)-4-vinyl-quinolin-6-ol Drug Info [527681]
2-(4-Hydroxy-phenyl)-7-isopropyl-benzooxazol-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-7-methoxy-benzofuran-5-ol Drug Info [527198]
2-(4-Hydroxy-phenyl)-7-methoxy-benzooxazol-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-7-methyl-benzofuran-5-ol Drug Info [527198]
2-(4-Hydroxy-phenyl)-7-phenyl-benzooxazol-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-7-propenyl-benzooxazol-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-7-propyl-benzooxazol-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-7-vinyl-benzooxazol-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-benzofuran-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-benzooxazol-6-ol Drug Info [527232]
2-(4-Hydroxy-phenyl)-quinolin-6-ol Drug Info [527681]
2-(4-hydroxyphenyl)-1,2'-spirobi[1H-indene]-5-ol Drug Info [526532]
2-(5-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol Drug Info [527232]
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-5-ol Drug Info [527232]
2-(6-Hydroxy-naphthalen-1-yl)-benzooxazol-6-ol Drug Info [527232]
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-5-ol Drug Info [527232]
2-(6-Hydroxy-naphthalen-2-yl)-benzooxazol-6-ol Drug Info [527232]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE Drug Info [551374]
2-Naphthalen-1-yl-benzooxazol-6-ol Drug Info [527232]
2-phenyl-1,2'-spirobi[1H-indene]-5'-ol Drug Info [526532]
3'-Methoxy-4'Hydroxyclomiphene Drug Info [533383]
3,8-dihydroxy-4-methyl-6H-benzo[c]chromen-6-one Drug Info [527966]
3,8-dihydroxy-7-methyl-6H-benzo[c]chromen-6-one Drug Info [527966]
3-(2-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol Drug Info [527232]
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-5-ol Drug Info [527232]
3-(4-Hydroxy-phenyl)-benzo[d]isoxazol-6-ol Drug Info [527232]
3-(4-Hydroxyphenyl)-7-isobutoxychromen-4-one Drug Info [531066]
3-(4-Hydroxyphenyl)-7-isopropoxychromen-4-one Drug Info [531066]
3-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol Drug Info [527232]
3-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol Drug Info [527232]
3-CHLORO-2-(4-HYDROXYPHENYL)-2H-INDAZOL-5-OL Drug Info [551374]
3-chloro-4-(4-hydroxyphenyl)salicylaldoxime Drug Info [529314]
3-ETHYL-2-(4-HYDROXYPHENYL)-2H-INDAZOL-5-OL Drug Info [551374]
3-hydroxy-8,10-dimethyl-6H-benzo[c]chromen-6-one Drug Info [527966]
3-[1-ethyl-2-(3-hydroxyphenyl)butyl]phenol Drug Info [533407]
4',5,7-trihydroxy-6,8-dimethylisoflavone Drug Info [526493]
4,10-dimethyl-6H-benzo[c]chromene-3,8-diol Drug Info [527966]
4,6,10-trimethyl-6H-benzo[c]chromene-3,8-diol Drug Info [527966]
4,6,6,7-tetramethyl-6H-benzo[c]chromene-3,8-diol Drug Info [527966]
4,6,7,10-tetramethyl-6H-benzo[c]chromene-3,8-diol Drug Info [527966]
4,6,7-trimethyl-6H-benzo[c]chromene-3,8-diol Drug Info [527966]
4,7-dimethyl-6H-benzo[c]chromene-3,8-diol Drug Info [527966]
4-(1,2-Diphenyl-but-1-enyl)-phenol Drug Info [526457]
4-(1-benzyl-7-chloro-1H-indazol-3-yl)phenol Drug Info [527327]
4-(1-butyl-7-chloro-1H-indazol-3-yl)phenol Drug Info [527327]
4-(1-cyclopentyl-7-fluoro-1H-indazol-3-yl)phenol Drug Info [527327]
4-(2-phenyl-1H-benzo[d]imidazol-1-yl)phenol Drug Info [527797]
4-(2-phenyl-1H-indol-3-yl)phenol Drug Info [527797]
4-(3-(4-hydroxyphenyl)-1H-indol-2-yl)phenol Drug Info [527797]
4-(3-phenyl-1H-indol-2-yl)phenol Drug Info [527797]
4-(5-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol Drug Info [527232]
4-(6-HYDROXY-1H-INDAZOL-3-YL)BENZENE-1,3-DIOL Drug Info [551374]
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,2-diol Drug Info [527232]
4-(6-Hydroxy-benzooxazol-2-yl)-benzene-1,3-diol Drug Info [527232]
4-(7-chloro-1-cyclohexyl-1H-indazol-3-yl)phenol Drug Info [527327]
4-(7-chloro-1-cyclopentyl-1H-indazol-3-yl)phenol Drug Info [527327]
4-(7-chloro-1-propyl-1H-indazol-3-yl)phenol Drug Info [527327]
4-(7-methyl-1-propyl-1H-indazol-3-yl)phenol Drug Info [527327]
4-Benzo[d]isoxazol-3-yl-benzene-1,3-diol Drug Info [527232]
4-benzyl-2,6-diisobutylamino-pyrimidine Drug Info [529687]
4-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol Drug Info [527681]
4-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol Drug Info [527681]
4-Ethyl-2-(4-hydroxy-phenyl)-quinolin-6-ol Drug Info [527681]
4-Ethynyl-2-(4-hydroxy-phenyl)-quinolin-6-ol Drug Info [527681]
4-hydroxy-N,N-diphenylbenzenesulfonamide Drug Info [527880]
4-hydroxy-N-isopropyl-N-phenylbenzenesulfonamide Drug Info [527880]
4-hydroxy-N-neopentyl-N-phenylbenzenesulfonamide Drug Info [527880]
4-hydroxy-N-phenyl-N-propylbenzenesulfonamide Drug Info [527880]
4-Naphthalen-2-yl-phenol Drug Info [527584]
4-[1,2-bis(4-hydroxyphenyl)but-1-enyl]phenol Drug Info [526589]
4-[1,2-bis(4-hydroxyphenyl)hex-1-enyl]phenol Drug Info [526589]
4-[1,2-bis(4-hydroxyphenyl)pent-1-enyl]phenol Drug Info [526589]
4-[1,2-bis(4-hydroxyphenyl)vinyl]phenol Drug Info [526589]
4-[1-(4-hydroxyphenyl)-2-phenylbut-1-enyl]phenol Drug Info [526457]
4-[1-(4-hydroxyphenyl)-2-phenylhex-1-enyl]phenol Drug Info [526457]
4-[1-(4-hydroxyphenyl)-2-phenylpent-1-enyl]phenol Drug Info [526457]
4-[1-(4-hydroxyphenyl)-2-phenylprop-1-enyl]phenol Drug Info [526457]
4-[1-(4-hydroxyphenyl)-2-phenylvinyl]phenol Drug Info [526457]
4-[2,2-bis(4-hydroxyphenyl)-1-methylvinyl]phenol Drug Info [526589]
5-Bromo-2-(4-hydroxy-phenyl)-quinolin-6-ol Drug Info [527681]
5-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-6-ol Drug Info [527232]
5-Chloro-2-(4-hydroxy-phenyl)-quinolin-6-ol Drug Info [527681]
5-hydroxy-2-phenylisoindoline-1,3-dione Drug Info [528481]
6-(2,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(2,6-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(2-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(2-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(3,5-Difluoro-4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(3-Chloro-4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(3-Fluoro-4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(3-Hydroxy-phenyl)-naphthalen-1-ol Drug Info [527584]
6-(3-Hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(4-Hydroxy-2-methoxy-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(4-Hydroxy-2-methyl-phenyl)-naphthalen-2-ol Drug Info [527584]
6-(4-Hydroxy-phenyl)-1-methoxy-naphthalen-2-ol Drug Info [527584]
6-(4-Hydroxy-phenyl)-1-methyl-naphthalen-2-ol Drug Info [527584]
6-(4-Hydroxy-phenyl)-1-nitro-naphthalen-2-ol Drug Info [527584]
6-(4-Hydroxy-phenyl)-1-phenyl-naphthalen-2-ol Drug Info [527584]
6-(4-Hydroxy-phenyl)-naphthalen-1-ol Drug Info [527584]
6-(4-Hydroxy-phenyl)-naphthalen-2-ol Drug Info [527681]
6-butyl-2,4-dipropylaminopyrimidine Drug Info [529687]
6-Chloro-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
6-ethyl-2,4-diisobutylaminopyrimidine Drug Info [529687]
6-ethyl-4,7-dimethyl-6H-benzo[c]chromene-3,8-diol Drug Info [527966]
6-Phenyl-naphthalen-2-ol Drug Info [527584]
7-(3-Hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
7-(4-Hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
7-Allyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
7-Bromo-2-(4-hydroxy-phenyl)-benzofuran-5-ol Drug Info [527198]
7-Bromo-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
7-Butyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
7-Chloro-2-(4-hydroxy-phenyl)-benzofuran-5-ol Drug Info [527198]
7-Cyclopentyloxy-3-(4-hydroxyphenyl)chromen-4-one Drug Info [531066]
7-Ethyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
7-Ethynyl-2-(4-hydroxy-phenyl)-benzooxazol-5-ol Drug Info [527232]
7-Phenyl-naphthalen-2-ol Drug Info [527584]
8-(2,2-dimethylpropyl)naringenin Drug Info [528557]
8-(2-methylpropyl)naringenin Drug Info [528557]
8-(3-methylbutyl)naringenin Drug Info [528557]
8-benzylnaringenin Drug Info [528557]
8-Chloro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
8-Fluoro-6-(4-hydroxy-phenyl)-naphthalen-2-ol Drug Info [527584]
8-methylnaringenin Drug Info [528557]
8-n-heptylnaringenin Drug Info [528557]
8-n-nonylnaringenin Drug Info [528557]
8-n-pentylnaringenin Drug Info [528557]
8-n-propylnaringenin Drug Info [528557]
8-n-undecylnaringenin Drug Info [528557]
ANDROSTENEDIOL Drug Info [529061]
ARZOXIFENE Drug Info [528827]
ATD transdermal gel Drug Info [543898]
BITHIONOL Drug Info [531262]
BROUSSONIN A Drug Info [530935]
Carboron Cluster with phenol Drug Info [526873]
Compound 15 Drug Info [551393]
Compound 16 Drug Info [551393]
Compound 19 Drug Info [551393]
Compound 4-D Drug Info [551393]
COUMESTROL Drug Info [527550]
CP-394531 Drug Info [526345]
CP-409069 Drug Info [526345]
DIADZEIN Drug Info [526493]
Dicarba-closo-dodecaborane derivative Drug Info [525663]
DIHYDRORALOXIFENE Drug Info [525493]
Doxorubicin-Formaldehyde Conjugate Drug Info [526966]
EFFUSOL Drug Info [527966]
ERA-923 Drug Info [528422]
Estrogen platinum(II) hybrid derivative Drug Info [527267]
Geldanamycin-estradiol hybrid Drug Info [525501]
GSK-5182 Drug Info [527895]
HEXESTROL Drug Info [551316]
ICI-164384 Drug Info [530807]
JNJ-17148066 Drug Info [530079]
JNJ-19398990 Drug Info [530079]
JNJ-26529126 Drug Info [530079]
JNJ-26529152 Drug Info [530079]
LTERHKILHRLLQEGSPSD Drug Info [528885]
LY-117018 Drug Info [531906]
MPrP Drug Info [529813]
MX-4509 Drug Info [550024]
N,N,N-Triisobutyl-pyrimidine-2,4,6-triamine Drug Info [529687]
N-allyl-4-hydroxy-N-phenylbenzenesulfonamide Drug Info [527880]
N-benzyl-4-hydroxy-N-phenylbenzenesulfonamide Drug Info [527880]
N-butyl-4-hydroxy-N-phenylbenzenesulfonamide Drug Info [527880]
N-cyclohexyl-4-hydroxy-N-phenylbenzenesulfonamide Drug Info [527880]
N-ethyl-4-hydroxy-N-phenylbenzenesulfonamide Drug Info [527880]
NAFOXIDINE Drug Info [534677]
Pipendoxifene Drug Info [526057]
SNG-163 Drug Info [543898]
SNG-8033 Drug Info [543898]
SOPHORAFLAVANONE B Drug Info [528557]
Tamoxifen butyl bromide Drug Info [531028]
Tamoxifen ethyl bromide Drug Info [531028]
Tamoxifen isopropyl bromide Drug Info [531028]
Tamoxifen methyl iodide Drug Info [531028]
WAY-169916 Drug Info [527327]
ZK-119010 Drug Info [531064]
ZK-164015 Drug Info [527179]
[1,1':2',1'']Terphenyl-4'-carbaldehyde oxime Drug Info [526711]
Modulator Acolbifene Drug Info [527443]
Afimoxifene Drug Info [543898]
ARN-810 Drug Info [533211]
Bazedoxifene Drug Info [530223], [551871]
BN-AA-003-NY Drug Info [548259]
BN-AO-014 Drug Info [548259]
BN-CB-045 Drug Info [548259]
BN-DF-037 Drug Info [548259]
BN-GU-005-DHP Drug Info [548259]
BN-OD-026 Drug Info [549739]
CC-8490 Drug Info [527343]
CHF-4227 Drug Info [526427]
Clomifene Drug Info [536404]
Clomiphene Citrate Drug Info [556264]
Conjugated estrogens a Drug Info [536361]
Conjugated estrogens b Drug Info [533439], [536361]
Cyclofenil Drug Info [528133], [551871]
Droloxifene Drug Info [533830]
Endoxifen Drug Info [543898]
Esterified estrogens Drug Info [531167], [551871]
Estetrol Drug Info [550049]
Estradiol Acetate Drug Info [556264]
Estradiol Cypionate Drug Info [556264]
Estradiol Valerate Drug Info [556264]
Estriol E3 Drug Info [531226]
Estrogen receptor beta-selective phytoestrogenic formulation Drug Info [527132]
Estropipate Drug Info [550912], [551871]
Fosfestrol Drug Info [527592], [530110]
Gestrinone Drug Info [536361]
GTx-758 Drug Info [532859]
ICARITIN Drug Info
Idoxifene Drug Info [534760]
IoGen Drug Info [543898]
Lasofoxifene Drug Info [549974]
Levormeloxifene non-steroidal Drug Info [526082], [551871]
Miproxifene Drug Info [525689]
Nomegestrol acetate Drug Info [526905], [533386], [551871]
NP-50301 Drug Info [529539]
NPC-01 Drug Info [523263]
Org-37663 Drug Info
Ospemifene Drug Info [551684]
Panomifene Drug Info [534524]
Premarin/Pravachol Drug Info [535747]
Premarin/Trimegestone Drug Info [544138], [551871]
Promestriene Drug Info [532496], [551871]
Quinestrol Drug Info [536324]
RAD-1901 Drug Info [533286]
Raloxifene Drug Info [543898]
RG6046 Drug Info [551871]
Selective estrogen receptor degraders Drug Info [543898]
SERM-3339 Drug Info [550861]
SERMs Drug Info [543898]
SR 16234 Drug Info [550429]
STX Drug Info [543898]
Synthetic conjugated estrogen Drug Info [526949], [551871]
Toremifene Drug Info [537376]
Trimegestone/ethinyl estradiol Drug Info [527538]
TSERaM Drug Info [543898]
Zindoxifene Drug Info [544032]
Agonist Androgen restored contraceptive Drug Info [543898]
Cenestin Drug Info [526290], [551871]
Dienestrol Drug Info [536915]
Diethylstilbestrol Drug Info [537525]
Estradiol Drug Info [537310]
Estratab Drug Info [534591], [551871]
Estriol Drug Info [537310]
Estrogen Drug Info [535417]
Estrone Drug Info [537310]
Ethinyl Estradiol Drug Info [537099], [537310]
HRT Drug Info [551907]
Mestranol Drug Info [536671]
propylpyrazoletriol Drug Info [525879]
R,R-THC Drug Info [534824]
SR-90067 Drug Info [551906]
Binder Chlorotrianisene Drug Info [537673]
Mitotane Drug Info [536081], [536207]
Antagonist Danazol Drug Info [537674]
EM-800 Drug Info [538072]
Fulvestrant Drug Info [537373]
GW7604 Drug Info [535101]
methyl-piperidino-pyrazole Drug Info [535376]
SNG-8006 Drug Info [543898]
Tamoxifen Drug Info [535410], [536925]
Trans-hydroxytamoxifen Drug Info [535376]
Target Expression Profile (TEP) and Drug Resistance Mutation (DRM)
TEP EXP Info
DRM DRM Info
Pathways
KEGG Pathway Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Proteoglycans in cancer
NetPath Pathway FSH Signaling Pathway
EGFR1 Signaling Pathway
RANKL Signaling Pathway
Pathway Interaction Database Regulation of nuclear SMAD2/3 signaling
Signaling events mediated by HDAC Class II
Plasma membrane estrogen receptor signaling
LKB1 signaling events
Regulation of Telomerase
ATF-2 transcription factor network
AP-1 transcription factor network
FOXM1 transcription factor network
Validated nuclear estrogen receptor alpha network
Signaling mediated by p38-alpha and p38-beta
FOXA1 transcription factor network
Reactome Nuclear signaling by ERBB4
Nuclear Receptor transcription pathway
WikiPathways Estrogen signaling pathway
Nuclear Receptors Meta-Pathway
Estrogen Receptor Pathway
Signaling by ERBB4
JAK/STAT
Integrated Pancreatic Cancer Pathway
Leptin signaling pathway
miR-targeted genes in muscle cell - TarBase
Integrated Breast Cancer Pathway
Nuclear Receptors
References
Ref 467663(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4325).
Ref 521581ClinicalTrials.gov (NCT00074646) Phase I Trial of CC-8490 for the Treatment of Subjects With Recurrent/Refractory High-Grade Gliomas. U.S. National Institutes of Health.
Ref 521695ClinicalTrials.gov (NCT00190697) A Study of LY353381 (Arzoxifene) for Patients Who Benefitted From This Drug in Other Oncology Trials and Wished to Continue Treatment. U.S. National Institutes of Health.
Ref 521779ClinicalTrials.gov (NCT00272714) Study of Afimoxifene Gel to Treat Cyclic Mastalgia in Premenopausal Women. U.S. National Institutes of Health.
Ref 521865ClinicalTrials.gov (NCT00361569) A Clinical Trial to Evaluate the Safety and Efficacy of DR-2041(Synthetic Conjugated Estrogens, A) for Treatment of Vulvovaginal Atrophy. U.S. National Institutes of Health.
Ref 522168ClinicalTrials.gov (NCT00563472) Feasibility Study Into the Contraceptive Effect of Estetrol. U.S. National Institutes of Health.
Ref 522627ClinicalTrials.gov (NCT00875420) A Study to Evaluate the Effects of RAD1901 in the Treatment of Vasomotor Symptoms in Postmenopausal Women. U.S. National Institutes of Health.
Ref 523263ClinicalTrials.gov (NCT01246791) Pharmacokinetics of NPC-01 After Single Oral Administration in Healthy Female Volunteers. U.S. National Institutes of Health.
Ref 523416ClinicalTrials.gov (NCT01326312) Effect of GTx-758 on Total and Free Testosterone Levels in Men With Prostate Cancer. U.S. National Institutes of Health.
Ref 523658ClinicalTrials.gov (NCT01452373) Dehydroepiandrosterone (DHEA) + Acolbifene Against Vasomotor Symptoms (Hot Flushes) in Postmenopausal Women. U.S. National Institutes of Health.
Ref 523817ClinicalTrials.gov (NCT01544894) Clinical Study of Raloxifene and Strontium Ranelate in Postmenopausal Osteoporosis. U.S. National Institutes of Health.
Ref 524250ClinicalTrials.gov (NCT01823835) A Study of ARN-810 (GDC-0810) in Postmenopausal Women With Locally Advanced or Metastatic Estrogen Receptor Positive Breast Cancer. U.S. National Institutes of Health.
Ref 524499ClinicalTrials.gov (NCT01972672) The Phase II Study of Icaritin in Patients With Advanced Hepatocellular Carcinoma. U.S. National Institutes of Health.
Ref 524681ClinicalTrials.gov (NCT02090400) Switching From Oral Bisphosphonates to Bazedoxifene to Evaluate Effects on Bone Mineral Density in Postmenopausal Women. U.S. National Institutes of Health.
Ref 525020ClinicalTrials.gov (NCT02311933) Tamoxifen Citrate or Z-Endoxifen Hydrochloride in Treating Patients With Locally Advanced or Metastatic, Estrogen Receptor-Positive, HER2-Negative Breast Cancer. U.S.National Institutes of Health.
Ref 526905An overview of nomegestrol acetate selective receptor binding and lack of estrogenic action on hormone-dependent cancer cells. J Steroid Biochem Mol Biol. 2003 Nov;87(2-3):111-22.
Ref 527054Treatment outcome in endodontics-the Toronto Study. Phase II: initial treatment. J Endod. 2004 May;30(5):302-9.
Ref 529380Pharmacological characterization of a novel oestrogen antagonist, ZK 119010, in rats and mice. J Endocrinol. 1991 Sep;130(3):409-14.
Ref 531544Estrogen receptor beta-selective phytoestrogenic formulation prevents physical and neurological changes in a preclinical model of human menopause. Menopause. 2011 Oct;18(10):1131-42.
Ref 531682Randomized double-blind phase 2 trial of 3 doses of TAS-108 in patients with advanced or metastatic postmenopausal breast cancer. Cancer. 2012 Jul 1;118(13):3244-53.
Ref 5326512013 FDA drug approvals. Nat Rev Drug Discov. 2014 Feb;13(2):85-9.
Ref 533386Regulation of rat uterine steroid receptors by nomegestrol acetate, a new 19-nor-progesterone derivative. J Pharmacol Exp Ther. 1989 Feb;248(2):758-61.
Ref 533402Carcinogenicity and metabolic activation of hexestrol. Chem Biol Interact. 1985 Oct;55(1-2):157-76.
Ref 533433Regulation of the estrogen receptor in MCF-7 cells by estradiol. Mol Endocrinol. 1988 Dec;2(12):1157-62.
Ref 534328Comparison of the ligand binding specificity and transcript tissue distribution of estrogen receptors alpha and beta. Endocrinology. 1997 Mar;138(3):863-70.
Ref 534694Estradiol regulates estrogen receptor mRNA stability. J Steroid Biochem Mol Biol. 1998 Aug;66(3):113-20.
Ref 535747Lovastatin and beyond: the history of the HMG-CoA reductase inhibitors. Nat Rev Drug Discov. 2003 Jul;2(7):517-26.
Ref 536296Emerging drugs for hypogonadism. Expert Opin Emerg Drugs. 2006 Nov;11(4):685-707.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536737Emerging drugs for idiopathic thrombocytopenic purpura in adults. Expert Opin Emerg Drugs. 2008 Jun;13(2):237-54.
Ref 536863Rational management of endocrine resistance in breast cancer: a comprehensive review of estrogen receptor biology, treatment options, and future directions. Cancer. 2008 Nov 1;113(9):2385-97.
Ref 538356FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (ANDA) 085239.
Ref 538391FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 006110.
Ref 538441FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 010976.
Ref 538481FDA Approved Drug Products from FDA Official Website. 2009. Application Number: (NDA) 016885.
Ref 538620(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1013).
Ref 538622(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1015).
Ref 538623(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1016).
Ref 539482(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2338).
Ref 539842(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2801).
Ref 539860(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2818).
Ref 539863(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2820).
Ref 539864(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2821).
Ref 539866(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2823).
Ref 541983(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6942).
Ref 541993(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6957).
Ref 542077(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7071).
Ref 542092(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7087).
Ref 542103(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7097).
Ref 542153(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7146).
Ref 542169(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7160).
Ref 542369(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7349).
Ref 542376(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7355).
Ref 542544(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7542).
Ref 542607(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7619).
Ref 544737Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000792)
Ref 544738Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000796)
Ref 544750Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000847)
Ref 544757Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000885)
Ref 544760Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000893)
Ref 545192Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002425)
Ref 545487Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003448)
Ref 546052Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006065)
Ref 546694Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009670)
Ref 546717Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800009862)
Ref 546799Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010354)
Ref 546947Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011425)
Ref 546955Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011554)
Ref 546969Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800011640)
Ref 547193Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800013842)
Ref 547436Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016303)
Ref 547486Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800016760)
Ref 547955Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800020680)
Ref 548161Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022636)
Ref 548258Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023897)
Ref 548351Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024900)
Ref 549961Clinical pipeline report, company report or official report of Lilly.
Ref 549974Pfizer. Product Development Pipeline. March 31 2009.
Ref 550696Drug information of Estriol, 2008. eduDrugs.
Ref 550697Drug information of Quinestrol, 2008. eduDrugs.
Ref 550715Drug information of Diethylstilbestrol, 2008. eduDrugs.
Ref 550720Drug information of Chlorotrianisene, 2008. eduDrugs.
Ref 551684Clinical pipeline report, company report or official report of Shionogi (2011).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 523263ClinicalTrials.gov (NCT01246791) Pharmacokinetics of NPC-01 After Single Oral Administration in Healthy Female Volunteers. U.S. National Institutes of Health.
Ref 525493Bioorg Med Chem Lett. 1999 Apr 19;9(8):1137-40.Synthesis and biological activity of trans-2,3-dihydroraloxifene.
Ref 525501Bioorg Med Chem Lett. 1999 May 3;9(9):1233-8.Synthesis and evaluation of geldanamycin-estradiol hybrids.
Ref 525663Bioorg Med Chem Lett. 1999 Dec 20;9(24):3387-92.Estrogenic antagonists bearing dicarba-closo-dodecaborane as a hydrophobic pharmacophore.
Ref 525689Estrogen agonistic/antagonistic effects of miproxifene phosphate (TAT-59)Shibata J1, Toko T, Saito H, Lykkesfeldt AE, Fujioka A, Sato K, Hashimoto A, Wierzba K, Yamada Y.Author information1Hanno Research Center, Taiho Pharmaceutical Co., Ltd., 1-27 Misugidai, Hanno-City, Saitama, 357-8527, Japan.Erratum inCancer Chemother Pharmacol 2000;46(2):172. AbstractPURPOSE: We evaluated miproxifene phosphate (TAT-59) to elucidate its efficacy in antiestrogen therapy for breast cancer patients and to assess its tissue-selective estrogenic/antiestrogenic activity.METHODS: Using DP-TAT-59, a major and active metabolite of TAT-59, an in vitro cell growth inhibition test was performed. Antitumor activity was determined using TAT-59 against human tumor xenografts of the MCF-7 and the Br-10 cell lines andMCF-7-derived tamoxifen-resistant cell lines, R-27 and FST-1. The antitumor activity of DP-TAT-59 and DM-DP-TAT-59, major metabolites of TAT-59 found in human blood following a TAT-59 dose, was also examined after intravenous administration to experimental animals. The residual estrogenic activity of TAT-59, evaluated in terms of bone and lipid metabolism in ovariectomized rats, was then comparedwith that of tamoxifen.RESULTS: DP-TAT-59 significantly inhibited the proliferation of estrogen receptor-positive MCF-7 and T-47D tumor cells in the presence of 1 nM estradiol. TAT-59, given to mice bearing MCF-7 or Br-10 xenografts, at the dose level of 5 mg/kg, exerted a significant growth inhibitory effect that was stronger than that of tamoxifen. Moreover, R-27 and FST-1 tumors, which show a resistance to tamoxifen, responded strongly to TAT-59, suggesting that TAT-59 might be effective against tumors resistant to tamoxifen. The metabolites of TAT-59, DP-TAT-59 and DM-DP-TAT-59, showed similar antitumor activity. Both TAT-59 and tamoxifen suppressed the decrease in bone density and reduced the blood cholesterol levels in ovariectomized rats, suggesting that the estrogenic activity of TAT-59 is comparable to that of tamoxifen.CONCLUSIONS: On the basis of the above results, one may expect TAT-59 to become an effective drug in patients with tumors less sensitive to tamoxifen, while its estrogenic activity as determined by bone and lipid metabolism is similar to that of tamoxifen.PMID: 10663628 [PubMed - indexed for MEDLINE] ShareMeSH Terms, SubstancesMeSH TermsAnimalsAntineoplastic Agents, Hormonal/pharmacologyBreast Neoplasms/pathology*Cell Division/drug effectsDrug Screening Assays, AntitumorEstradiol/pharmacologyEstrogen Antagonists/pharmacology*FemaleHumansLipid MetabolismMiceMice, Inbred BALB CRatsRats, Sprague-DawleyReceptors, Estrogen/physiologyTamoxifen/analogs & derivatives*Tamoxifen/pharmacologyTransplantation, HeterologousTumor Cells, Cultured/drug effectsSubstancesAntineoplastic Agents, HormonalEstrogen AntagonistsReceptors, EstrogenTamoxifenTAT 59EstradiolLinkOut - more resourcesOther Literature SourcesAccess more work from the authors - ResearchGateMedicalBreast Cancer - MedlinePlus Health InformationMiscellaneousESTRADIOL - Hazardous Substances Data BankTAMOXIFEN - Hazardous Substances Data BankPubMed Commons home Cancer Chemother Pharmacol. 2000;45(2):133-41.
Ref 525879Conformational changes and coactivator recruitment by novel ligands for estrogen receptor-alpha and estrogen receptor-beta: correlations with biological character and distinct differences among SRC coactivator family members. Endocrinology. 2000 Oct;141(10):3534-45.
Ref 526057J Med Chem. 2001 May 24;44(11):1654-7.Design, synthesis, and preclinical characterization of novel, highly selective indole estrogens.
Ref 526082Centchroman, a selective estrogen receptor modulator, as a contraceptive and for the management of hormone-related clinical disorders. Med Res Rev. 2001 Jul;21(4):302-47.
Ref 526290Estrogen replacement therapy and cardioprotection: mechanisms and controversies. Braz J Med Biol Res. 2002 Mar;35(3):271-6.
Ref 526345J Med Chem. 2002 Jun 6;45(12):2417-24.Discovery of potent, nonsteroidal, and highly selective glucocorticoid receptor antagonists.
Ref 526427Pharmacological actions of a novel, potent, tissue-selective benzopyran estrogen. J Pharmacol Exp Ther. 2002 Oct;303(1):196-203.
Ref 526457J Med Chem. 2002 Nov 21;45(24):5358-64.Investigations on estrogen receptor binding. The estrogenic, antiestrogenic, and cytotoxic properties of C2-alkyl-substituted 1,1-bis(4-hydroxyphenyl)-2-phenylethenes.
Ref 526493J Nat Prod. 2002 Dec;65(12):1749-53.Isolation and structure elucidation of an isoflavone and a sesterterpenoic acid from Henriettella fascicularis.
Ref 526532Bioorg Med Chem Lett. 2003 Feb 10;13(3):479-83.2-Phenylspiroindenes: a novel class of selective estrogen receptor modulators (SERMs).
Ref 526589J Med Chem. 2003 Apr 10;46(8):1484-91.Antiestrogenically active 1,1,2-tris(4-hydroxyphenyl)alkenes without basic side chain: synthesis and biological activity.
Ref 526711J Med Chem. 2003 Sep 11;46(19):4032-42.Novel estrogen receptor ligands based on an anthranylaldoxime structure: role of the phenol-type pseudocycle in the binding process.
Ref 526873Bioorg Med Chem Lett. 2003 Nov 17;13(22):4089-92.Utility of boron clusters for drug design. Relation between estrogen receptor binding affinity and hydrophobicity of phenols bearing various types of carboranyl groups.
Ref 526905An overview of nomegestrol acetate selective receptor binding and lack of estrogenic action on hormone-dependent cancer cells. J Steroid Biochem Mol Biol. 2003 Nov;87(2-3):111-22.
Ref 526949Relief of hot flushes with new plant-derived 10-component synthetic conjugated estrogens. Obstet Gynecol. 2004 Feb;103(2):245-53.
Ref 526966J Med Chem. 2004 Feb 26;47(5):1193-206.Design, synthesis, and biological evaluation of doxorubicin-formaldehyde conjugates targeted to breast cancer cells.
Ref 527132A structural explanation for ERalpha/ERbeta SERM discrimination. Ernst Schering Res Found Workshop. 2004;(46):33-45.
Ref 527179Bioorg Med Chem Lett. 2004 Sep 20;14(18):4659-63.Synthesis and biological evaluation of stilbene-based pure estrogen antagonists.
Ref 527198Bioorg Med Chem Lett. 2004 Oct 4;14(19):4925-9.7-Substituted 2-phenyl-benzofurans as ER beta selective ligands.
Ref 527232J Med Chem. 2004 Oct 7;47(21):5021-40.Design and synthesis of aryl diphenolic azoles as potent and selective estrogen receptor-beta ligands.
Ref 527267Bioorg Med Chem Lett. 2004 Dec 6;14(23):5919-24.Biological evaluation of novel estrogen-platinum(II) hybrid molecules on uterine and ovarian cancers-molecular modeling studies.
Ref 527327J Med Chem. 2004 Dec 16;47(26):6435-8.Synthesis and activity of substituted 4-(indazol-3-yl)phenols as pathway-selective estrogen receptor ligands useful in the treatment of rheumatoid arthritis.
Ref 527343Agents with selective estrogen receptor (ER) modulator activity induce apoptosis in vitro and in vivo in ER-negative glioma cells. Cancer Res. 2004 Dec 15;64(24):9115-23.
Ref 527443Bioactivation of the selective estrogen receptor modulator acolbifene to quinone methides. Chem Res Toxicol. 2005 Feb;18(2):174-82.
Ref 527538Differential effects of estrogens and progestins on the anticoagulant tissue factor pathway inhibitor in the rat. J Steroid Biochem Mol Biol. 2005 Mar;94(4):361-8.
Ref 527550J Med Chem. 2005 May 19;48(10):3463-6.Structure-based virtual screening for plant-based ERbeta-selective ligands as potential preventative therapy against age-related neurodegenerative diseases.
Ref 527584J Med Chem. 2005 Jun 16;48(12):3953-79.ERbeta ligands. 3. Exploiting two binding orientations of the 2-phenylnaphthalene scaffold to achieve ERbeta selectivity.
Ref 527592Assay of the synthetic estrogen fosfestrol in pharmaceutical formulations using capillary electrophoresis. J Pharm Biomed Anal. 2005 Sep 15;39(3-4):559-63.
Ref 527681Bioorg Med Chem Lett. 2005 Oct 15;15(20):4520-5.ERbeta ligands. Part 4: Synthesis and structure-activity relationships of a series of 2-phenylquinoline derivatives.
Ref 527738J Med Chem. 2005 Sep 22;48(19):5989-6003.Differential response of estrogen receptor subtypes to 1,3-diarylindene and 2,3-diarylindene ligands.
Ref 527797Bioorg Med Chem Lett. 2005 Dec 15;15(24):5562-6. Epub 2005 Oct 10.Estrogen receptor beta selective ligands: discovery and SAR of novel heterocyclic ligands.
Ref 527880Bioorg Med Chem Lett. 2006 Feb 15;16(4):854-8. Epub 2005 Nov 21.Substituted 4-hydroxyphenyl sulfonamides as pathway-selective estrogen receptor ligands.
Ref 527895Bioorg Med Chem Lett. 2006 Feb 15;16(4):821-4. Epub 2005 Nov 22.Structure-guided synthesis of tamoxifen analogs with improved selectivity for the orphan ERRgamma.
Ref 527966Bioorg Med Chem Lett. 2006 Mar 15;16(6):1468-72. Epub 2006 Jan 18.6H-Benzo[c]chromen-6-one derivatives as selective ERbeta agonists.
Ref 528133Fluorine-substituted cyclofenil derivatives as estrogen receptor ligands: synthesis and structure-affinity relationship study of potential positron emission tomography agents for imaging estrogen receptors in breast cancer. J Med Chem. 2006 Apr 20;49(8):2496-511.
Ref 528422Combination therapy for treating breast cancer using antiestrogen, ERA-923, and the mammalian target of rapamycin inhibitor, temsirolimus. Endocr Relat Cancer. 2006 Sep;13(3):863-73.
Ref 528481Bioorg Med Chem Lett. 2007 Jan 1;17(1):118-22. Epub 2006 Oct 1.Estrogen receptor beta ligands: design and synthesis of new 2-phenyl-isoindole-1,3-diones.
Ref 528557J Med Chem. 2006 Dec 14;49(25):7357-65.Subtle side-chain modifications of the hop phytoestrogen 8-prenylnaringenin result in distinct agonist/antagonist activity profiles for estrogen receptors alphaand beta.
Ref 528827J Med Chem. 2007 May 31;50(11):2682-92. Epub 2007 May 10.Benzothiophene selective estrogen receptor modulators with modulated oxidative activity and receptor affinity.
Ref 528885Bioorg Med Chem Lett. 2007 Aug 1;17(15):4118-22. Epub 2007 May 23.Bicyclo[2.2.2]octanes: close structural mimics of the nuclear receptor-binding motif of steroid receptor coactivators.
Ref 529061Bioorg Med Chem Lett. 2007 Nov 15;17(22):6295-8. Epub 2007 Sep 7.Androstene-3,5-dienes as ER-beta selective SERMs.
Ref 529314J Med Chem. 2008 Mar 13;51(5):1344-51. Epub 2008 Feb 13.Monoaryl-substituted salicylaldoximes as ligands for estrogen receptor beta.
Ref 529539Therapeutic targets in dry eye syndrome. Drug News Perspect. 2008 Apr;21(3):166-76.
Ref 529687J Med Chem. 2008 Oct 23;51(20):6512-30. Epub 2008 Sep 12.Blocking estrogen signaling after the hormone: pyrimidine-core inhibitors of estrogen receptor-coactivator binding.
Ref 529813Bioorg Med Chem Lett. 2009 Jan 1;19(1):108-10. Epub 2008 Nov 6.Analogs of methyl-piperidinopyrazole (MPP): antiestrogens with estrogen receptor alpha selective activity.
Ref 530079J Med Chem. 2009 Dec 10;52(23):7544-69.Identification and structure-activity relationships of chromene-derived selective estrogen receptor modulators for treatment of postmenopausal symptoms.
Ref 530110Impact of natural products on developing new anti-cancer agents. Chem Rev. 2009 Jul;109(7):3012-43.
Ref 530223Bazedoxifene, a selective estrogen receptor modulator: effects on the endometrium, ovaries, and breast from a randomized controlled trial in osteoporotic postmenopausal women. Menopause. 2009 Nov-Dec;16(6):1109-15.
Ref 530807J Med Chem. 1991 May;34(5):1624-30.Synthesis and biological activity of new halo-steroidal antiestrogens.
Ref 530935Bioorg Med Chem Lett. 2010 Jun 15;20(12):3764-7. Epub 2010 Apr 19.New estrogenic compounds isolated from Broussonetia kazinoki.
Ref 531028Bioorg Med Chem. 2010 Aug 1;18(15):5593-601. Epub 2010 Jun 20.Genomic action of permanently charged tamoxifen derivatives via estrogen receptor-alpha.
Ref 531064J Med Chem. 1991 Jul;34(7):2145-52.2-Phenylindole-linked [2-(aminoalkyl)pyridine]dichloroplatinum(II): complexes with a selective action on estrogen receptor positive mammary tumors.
Ref 531066J Med Chem. 2010 Aug 26;53(16):6153-63.Effects of 7-O substitutions on estrogenic and anti-estrogenic activities of daidzein analogues in MCF-7 breast cancer cells.
Ref 531167Safety and efficacy of low-dose esterified estrogens and methyltestosterone, alone or combined, for the treatment of hot flashes in menopausal women: a randomized, double-blind, placebo-controlled study. Fertil Steril. 2011 Jan;95(1):366-8.
Ref 531226Estrogen: estrone (E1), estradiol (E2), estriol (E3) and estetrol (E4). Nihon Rinsho. 2010 Jul;68 Suppl 7:448-61.
Ref 531262Bioorg Med Chem Lett. 2010 Dec 15;20(24):7331-6. Epub 2010 Oct 21.In silico identification and biochemical evaluation of novel inhibitors of NRH:quinone oxidoreductase 2 (NQO2).
Ref 531906J Med Chem. 1990 Dec;33(12):3222-9.Structure-activity relationship of antiestrogens. Phenolic analogues of 2,3-diaryl-2H-1-benzopyrans.
Ref 532496Promestriene, a specific topic estrogen. Review of 40 years of vaginal atrophy treatment: is it safe even in cancer patients. Anticancer Drugs. 2013 Nov;24(10):989-98.
Ref 532859Selective estrogen receptor alpha agonist GTx-758 decreases testosterone with reduced side effects of androgen deprivation therapy in men with advanced prostate cancer. Eur Urol. 2015 Feb;67(2):334-41.
Ref 533211Identification of GDC-0810 (ARN-810), an Orally Bioavailable Selective Estrogen Receptor Degrader (SERD) that Demonstrates Robust Activity in Tamoxifen-Resistant Breast Cancer Xenografts. J Med Chem.2015 Jun 25;58(12):4888-904.
Ref 533286RAD1901: a novel, orally bioavailable selective estrogen receptor degrader that demonstrates antitumor activity in breast cancer xenograft models. Anticancer Drugs. 2015 Oct;26(9):948-56.
Ref 533383J Med Chem. 1989 Jan;32(1):192-7.Phenolic metabolites of clomiphene: [(E,Z)-2-[4-(1,2-diphenyl-2-chlorovinyl)phenoxy]ethyl]diethylamine. Preparation, electrophilicity, and effects in MCF 7 breast cancer cells.
Ref 533386Regulation of rat uterine steroid receptors by nomegestrol acetate, a new 19-nor-progesterone derivative. J Pharmacol Exp Ther. 1989 Feb;248(2):758-61.
Ref 533407J Med Chem. 1986 Sep;29(9):1668-74.Influence of alkyl chain ramification on estradiol receptor binding affinity and intrinsic activity of 1,2-dialkylated 1,2-bis(4- or 3-hydroxyphenyl)ethane estrogens and antiestrogens.
Ref 533439Effect of MK-486 alone on Parkinsonism; studies on the clinical symptoms and catecholamine concentrations in the blood, urine and cerebrospinal fluid. No To Shinkei. 1977 Feb;29(2):205-13.
Ref 533830Droloxifene, a new antiestrogen: its role in metastatic breast cancer. Breast Cancer Res Treat. 1994;31(1):83-94.
Ref 534524Species differences in metabolism of panomifene, an analogue of tamoxifen. Drug Metab Dispos. 1997 Dec;25(12):1370-8.
Ref 534591Low-dose esterified estrogen therapy: effects on bone, plasma estradiol concentrations, endometrium, and lipid levels. Estratab/Osteoporosis Study Group. Arch Intern Med. 1997 Dec 8-22;157(22):2609-15.
Ref 534677J Med Chem. 1998 Jul 30;41(16):2928-31.Discovery and preclinical pharmacology of a novel, potent, nonsteroidal estrogen receptor agonist/antagonist, CP-336156, a diaryltetrahydronaphthalene.
Ref 534760Idoxifene: a novel selective estrogen receptor modulator prevents bone loss and lowers cholesterol levels in ovariectomized rats and decreases uterine weight in intact rats. Endocrinology. 1998 Dec;139(12):5224-34.
Ref 534824Novel ligands that function as selective estrogens or antiestrogens for estrogen receptor-alpha or estrogen receptor-beta. Endocrinology. 1999 Feb;140(2):800-4.
Ref 535101Molecular mechanism of action at estrogen receptor alpha of a new clinically relevant antiestrogen (GW7604) related to tamoxifen. Endocrinology. 2001 Feb;142(2):838-46.
Ref 535376Antagonists selective for estrogen receptor alpha. Endocrinology. 2002 Mar;143(3):941-7.
Ref 535410Chemoprevention for high-risk women: tamoxifen and beyond. Breast J. 2001 Sep-Oct;7(5):311-20.
Ref 535417Estrogen-receptor polymorphisms and effects of estrogen replacement on high-density lipoprotein cholesterol in women with coronary disease. N Engl J Med. 2002 Mar 28;346(13):967-74.
Ref 535747Lovastatin and beyond: the history of the HMG-CoA reductase inhibitors. Nat Rev Drug Discov. 2003 Jul;2(7):517-26.
Ref 536081Mitotane for adrenocortical carcinoma treatment. Curr Opin Investig Drugs. 2005 Apr;6(4):386-94.
Ref 536207Mitotane has an estrogenic effect on sex hormone-binding globulin and corticosteroid-binding globulin in humans. J Clin Endocrinol Metab. 2006 Jun;91(6):2165-70. Epub 2006 Mar 21.
Ref 536324The antioxidant effect of estrogen and Selective Estrogen Receptor Modulators in the inhibition of osteocyte apoptosis in vitro. Bone. 2007 Mar;40(3):674-84. Epub 2006 Dec 13.
Ref 536361Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. Epub 2007 Feb 20.
Ref 536404The future of the new selective estrogen receptor modulators. Menopause Int. 2007 Mar;13(1):27-34.
Ref 536671Short-term effects of environmentally relevant concentrations of EDC mixtures on Mytilus galloprovincialis digestive gland. Aquat Toxicol. 2008 May 30;87(4):272-9. Epub 2008 Mar 10.
Ref 536915Potential use of an estrogen-glucocorticoid receptor chimera as a drug screen for tissue selective estrogenic activity. Bone. 2009 Jan;44(1):102-12. Epub 2008 Oct 11.
Ref 536925Modulators of vascular sex hormone receptors and their effects in estrogen-deficiency states associated with menopause. Recent Pat Cardiovasc Drug Discov. 2008 Nov;3(3):165-86.
Ref 53709917alpha-Ethinylestradiol hinders nucleotide excision repair in zebrafish liver cells. Aquat Toxicol. 2009 Jan 23.
Ref 537310Reprint of Are all estrogens the same? Maturitas. 2008 Sep-Oct;61(1-2):195-201.
Ref 537373Beta3-tubulin is induced by estradiol in human breast carcinoma cells through an estrogen-receptor dependent pathway. Cell Motil Cytoskeleton. 2009 Jul;66(7):378-88.
Ref 537376Effect of selective estrogen receptor modulators on cell proliferation and estrogen receptor activities in normal human prostate stromal and epithelial cells. Prostate Cancer Prostatic Dis. 2009 May 26.
Ref 537525Effects of Diethylstilbestrol on Programmed Oocyte Death and Induction of Polyovular Follicles in Neonatal Mouse Ovaries. Biol Reprod. 2009 Jun 24.
Ref 537673Inactivation of the uterine estrogen receptor binding of estradiol during P-450 catalyzed metabolism of chlorotrianisene (TACE). Speculation that TACE antiestrogenic activity involves covalent binding to the estrogen receptor. FEBS Lett. 1990 Feb 12;261(1):59-62.
Ref 537674Danazol suppression of luteinizing hormone in the rat: evidence for mediation by both androgen and estrogen receptors. Proc Soc Exp Biol Med. 1990 May;194(1):54-7.
Ref 538072EM-800, a novel antiestrogen, acts as a pure antagonist of the transcriptional functions of estrogen receptors alpha and beta. Endocrinology. 1998 Jan;139(1):111-8.
Ref 543898(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 620).
Ref 544032Phase I/II study of the anti-oestrogen zindoxifene (D16726) in the treatment of advanced breast cancer. A Cancer Research Campaign Phase I/II Clinical Trials Committee study.. Br J Cancer. 1990 March; 61(3): 451-453.
Ref 544138The Haunting of Medical Journals: How Ghostwriting Sold ??RT?? PLoS Med. 2010 September; 7(9): e1000335.
Ref 548259Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800023897)
Ref 549739Clinical pipeline report, company report or official report of Bionovo.
Ref 549974Pfizer. Product Development Pipeline. March 31 2009.
Ref 550024Review of the effects of 17alpha-estradiol in humans: a less feminizing estrogen with neuroprotective potential. Article first published online: 9 FEB 2009.
Ref 550049Clinical pipeline report, company report or official report of Pantarhei Bioscience.
Ref 550429National Cancer Institute Drug Dictionary (drug id 599816).
Ref 550861CN patent application no. 102406650, Sex steroid precursors alone or in combination with selective estrogen receptor modulator for prevention and treatment of vaginal dryness and sexual dysfunction in postmenop.
Ref 550912US patent application no. 5,004,651, Stabilizing system for solid dosage forms.
Ref 551316Bone targeted drugs 2. synthesis of estrogens with hydroxyapatite affinity, Bioorg. Med. Chem. Lett. 6(9):1047-1050 (1996).
Ref 551374The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
Ref 551393How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
Ref 551684Clinical pipeline report, company report or official report of Shionogi (2011).
Ref 551871Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
Ref 551906US patent application no. 2010,0278,784, Methods and compositions for treating skin conditions.
Ref 551907US patent application no. 2010,0278,784, Methods and compositions for treating skin conditions.
Ref 556264Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
Ref 1587926URL: https://www.ebi.ac.uk/chembl/ The ChEMBL database in 2017

If you find any error in data or bug in web service, please kindly report it to Dr. Yin and Dr. Li.